Template:Citation/doc: Difference between revisions
imported>DavidBrooks (author-link is canonical) |
No edit summary |
||
| Line 1: | Line 1: | ||
documentation subpage |
|||
categories go where indicated at the bottom this pagepleaseinterwikis go toWikidatasee alsowikipediawukidataforthenbspcitation neededtemplatetlcitation neededifeqpagenamehootpagenamecascadeprotected templateifeqpagenamerootpagenanehighrisk189000csdoclualua |
|||
<!-- Categories go where indicated at the bottom of this page, please; interwikis go to Wikidata (see also: [[Wikipedia:Wikidata]]). --> |
|||
thecitationtemplate generates a citation for a bookperiodicalcontribution in a collective work or a web page it determines the citation type by examining which parameters are used as with other citation templatesthis template can be used either in a footnotebetweentagreftagsor in a section that lists sourcesthis template uses the same lualuacode ashelpcitationstylecitation style templates with parameters to change the displayed format tohelpcitationstylecitation style |
|||
{{for2|the{{nbsp}} {{fake citation needed}} template|{{tl|citation needed}}}} |
|||
if the correct parameters are used this template produces output identical to thatthe cite templates such as tl cite book andty cite webwith one important exceptionby defaultthis citation template uses commas in places where the cite templates use periods full stops by default either type template can use periodsfull stops or commas by using an optional parameter regardlesswhich citation templates are used or even if none are used at allall citations should have the same format throughout an article in the savedrendered text |
|||
{{#ifeq: {{PAGENAME}}|{{ROOTPAGENAME}}|{{Cascade-protected template}}}} |
|||
noteall parameternames must belowercasesimple citation |
|||
{{#ifeq: {{PAGENAME}}|{{ROOTPAGENAME}}|{{High-risk|189000+}}}} |
|||
this section covers the most com monly used parameters you can copy the horizontal form or vertical form below and then add in extra parameters from the full listspacing and orderingthe parameters within the template is irrelevant and does not affect the final rendered textcodenowiki citation lastfirstyeartitlepublisherpublicationplacepageuraccessdatenowikicodeclasswikitableprecitation |
|||
{{csdoc|lua|lua=yes}} |
|||
lastfirstyeartitlepublisher publicationplacepageurl accessdatepre |
|||
The '''Citation''' template generates a citation for a book, periodical, contribution in a collective work, or a web page. It determines the citation type by examining which parameters are used. As with other citation templates, this template can be used either in a footnote (between {{tag|ref}} tags) or in a section that lists sources. This template uses the same [[WP:Lua|Lua]] code as [[help:Citation Style 1|citation style 1 (CS1)]] templates with parameters to change the displayed format to [[help:Citation Style 2|citation style 2 (CS2)]]. |
|||
lastthe authors surname or last namedont use with theauthorparameterfirstthe author's first or given name(s)yearyear authorship or publication mandatory for use with links fromtemplateharvard citationunlessparadatespecifies both month and yeartitleitlethe work mandatory for web references |
|||
publisherthe name the publisheromit terms such as publisherscoincktdetcbut retain the wordsbooksor pressnot normally included where the publication is a periodical which has its own wikipedia articleeg newsweekbillboarmagazinebillboard]publicationplaceorplaceorlocationthe citypublication if more than one town city is listed on the title page give the first one or the locationthe publisher's head office omit when the publication is a periodical whose name specifies the location e gthe new york times the times india pageFor use when one page is cited adds pbefore the page number do not use with pagesurlauniform resource locator urlan online location where the item can be found if the url includes double quotes these must be encoded asaccessdatedateref groupn namedateswhen the url was accessedexampleclasswikitableprecitationlastturnerfirstorsamus |
|||
If the correct parameters are used, this template produces output identical to that of the Cite templates, such as {{Tl|Cite book}} and {{Tl|Cite web}}, with one important exception: By default, this Citation template uses commas in places where the Cite templates use periods (full stops) by default; either type of template can use periods (full stops) or commas by using an optional parameter. |
|||
titlehistorythe pioneer settlement |
|||
phelps and gorham's purchaseand morrisreservepublisherwilliam alling |
|||
Regardless of which citation templates are used or even if none are used at all, all citations should have the same format throughout an article in the saved, rendered text. |
|||
placerochesternewyorkyear 1851ol7120924Wprecitation |
|||
lastturnerfirstorsamustitlehistory the pioneer settlement phelps and gorhams purchase and morris reserve |
|||
Note: All parameter names must be [[lowercase]]. |
|||
publisherwilliamalling |
|||
placerochesternew york |
|||
==Simple citations== |
|||
year1851ol7120924wfull citation parametersnoticethis section needs to be edited it includes deprecated parameters and does not include parameters that were added in the updatesthese can be used for all types publicationallare optional and indentation is used simply to group related items these may be mutually exclusive where indicated. some hyphenated names can also be placed without hyphensclasswikitableprecitation |
|||
This section covers the most commonly used parameters. You can copy the horizontal form or vertical form below and then add in extra parameters from the full list. Spacing and ordering of the parameters within the template is irrelevant and does not affect the final, rendered text. |
|||
authorlastfirst author last first author link author link authorseparator author name separator author mask displayauthorseditoreditor last editorfirsteditoreditorlast editorfirst editorlinkeditorlink translatorlasttranslatorfirsttranslatorlink translatorlast translatorfirst translatorlinkothers publicationdatedateyearorigyeartitle chapterchapterur chapterformatcontribution contributionurtype journalperiodicalnewspapermagazine encyclopediaworkeditionseriesvolume issuepublisherpublicationplace place |
|||
languagepagepagesnoppatidisbnissnoclcpmid pmcbibcodedoi doiinactive date |
|||
<code><nowiki>{{Citation |last= |first= |year= |title= |publisher= |publication-place= |page= |url= |access-date=}}</nowiki></code> |
|||
zbl |
|||
urlaccessdate |
|||
{| class="wikitable" |
|||
format |
|||
|- |
|||
archiveurl |
|||
| <pre>{{Citation |
|||
archivedate |
|||
| last = |
|||
urlstatus |
|||
| first = |
|||
quote |
|||
layurl |
|||
| title = |
|||
laysource |
|||
| publisher = |
|||
laydateseparator postscriref preparameterssyntaxcsdocsyntaxluacsdocsepcommaluaacsdoccoinsluaswhats newcsdocwhats newdeprecatedcsdocdeprecatedluadescriptionauthorscsdocauthorluacontributoryesothersyeseditorscsdoceditorlua |
|||
| publication-place = |
|||
titlecsdoctitleluatitleformatitalicscsdocchapterluacsdoctypelua |
|||
| page = |
|||
csdoclanguagelua |
|||
| url = |
|||
datecsdocdateluawork |
|||
| access-date = |
|||
csdocjournalluapublishecsdocpublisherluaeditionseriesvolumecsdocedition|luacsdocseriesluacsdocvolumeluainsource locationscsdocpagesluaurlanchorurcsdocurlchapteranchorchapterurcsdocchapterurlluaanchor |
|||
}}</pre> |
|||
csdocrefluaidentifiersanchoridcsdocidlua |
|||
|} |
|||
anchoridcsdocidluaquotecsdocquoteluacslaysummarycsdoclaydisplay optionscsdocdisplayluanosubscription or registration requiredcsdocregistrationluaexamplesbooksclasswikitablethree authorsa volumeand an editionampersandampforced before final authors nameprecitation |
|||
* '''last''': The author's surname or last name. Don't use with the '''author''' parameter. |
|||
lastlincolnfirstalastwashingtonfirst glastadamsfirstjnameliststyle amptitleall thepresidentsnames |
|||
* '''first''': The author's first or given name(s). |
|||
publisherthe pentagon |
|||
* '''year''': Year of authorship or publication. Mandatory for use with links from [[:Template:Harvard citation]], unless {{para|date}} specifies both month and year. |
|||
placehomebasenewyorkvolume xiieditionndyear 200precitationlastlincolnfirstlast washingtonfirstg |
|||
* '''title''': Title of the work. Mandatory for web references. |
|||
lastadams |
|||
* '''publisher''': The name of the publisher. Omit terms such as ''Publishers'', ''Co.'', ''Inc.'', ''Ltd.'', etc., but retain the words ''Books'' or ''Press''. Not normally included where the publication is a periodical which has its own Wikipedia article (e.g. ''[[Newsweek]]'', ''[[Billboard (magazine)|Billboard]]''). |
|||
firstj |
|||
** '''publication-place''' (or '''place''' or '''location'''): The city of publication. If more than one town/city is listed on the title page, give the first one or the location of the publisher's head office. Omit when the publication is a periodical whose name specifies the location (e.g. ''The New York Times'', ''The Times of India'') |
|||
nameliststyleamp |
|||
* '''page''': For use when one page is cited. Adds "p." before the page number. Do not use with '''pages'''. |
|||
titleallthepresidents namespublisherthepentagonplace home basenewyork |
|||
* '''url''': A [[Uniform resource locator|url]] of an online location where the item can be found. If the url includes double quotes, these must be encoded as "%22". |
|||
volume xiieditionndyear2007webclasswikitablewebpageprecitationurl httpnrhpfocusnpsgovtitle npsfocusworknationalregister oHistoric placespublishernationalpark serviceaccessdatenovember302010ref noneprecitationurlhttpnrhpfocusnpsgovtitle nps focusworknational registerhistoric placespublishernationalpark serviceaccessdatenovember302010ref none |
|||
** '''access-date''': Date<ref group="n" name="dates" /> when the url was accessed. |
|||
archived pageprecitatio url httpliftoffmsfcnasagovacademyspaceatmospherehtmltitleearth's Atmosphereaccessdateoctober 25 2007 publishernational aeronautics and space administration]year 1995authornassaarchiveurl httpwebarchiveorgweb20071013232332http |
|||
liftoffmsfcnasagovacademyspaceatmospherehtmlarchivedateoctober 13 200precitationurl httpliftoffmsfcnasagovacademyspaceatmospherehtmltitleearth's atmosphereaccessdateoctober 252007publishernationalaeronautics and space administration year1995 authornassaarchiveurl httpwebarchiveorgweb20071013232332httpliftoffmsfcnasagovacademyspaceatmospherehtmlarchivedateoctober 13 2007journalsnewspapersmagazines or other periodicalsclasswikitablejournal article |
|||
===Example=== |
|||
precitationlasthillfirstmarvin s |
|||
{| class="wikitable" |
|||
titlejosephsmithandthe1826 |
|||
|- |
|||
trialnew evidence and new |
|||
| <pre>{{Citation |
|||
Difficultiesjournalbyustudies |
|||
| last = Turner |
|||
volume issueyear197pages18url httpbyustudiesbyuedushoppDFSRC122hillpdf |
|||
| first = Orsamus |
|||
prcitationlasthillfirsrmarvin stitle joseph smith and the 1826 trialnew evidence and new difficultiesjournal byu studiesvolume12issueyear1976pages 18 |
|||
| title = History of the pioneer settlement of |
|||
urlhttpbyustudiesbyuedushoppdfsrc122hillpdfJournalarticle with multiple authors and identifier |
|||
Phelps and Gorham's purchase, and Morris' reserve |
|||
precitation lastmandelkern |
|||
| publisher = William Alling |
|||
firstmlasteliasfirstjlastedenfirst dlastcrothersfirstddisplayauthors title the dimension dna in solutionjournal h mol biolvolume 152issue pages 153161year1981pmid7338906 |
|||
| place = Rochester, New York |
|||
doi1010160022283681900991 |
|||
| year = 1851 |
|||
precitationlastmandelkern |
|||
| ol = 7120924W |
|||
firstmlaseliasfirsjlasedenfirsdlas crothersfirsddisplayauthorstitlethe dimensions dnain solutionjournaljmolbiovolume 152issuepages153161year1981pmid 7338906 |
|||
}} |
|||
doi1010160022283681900991newspaper articleprecitationlastsmithfirstjoseph authorlinkjosephsmith |
|||
</pre> |
|||
titlelasttestimonysister emmanewspaperthesaintsheraldlocationplanoilvolume 26issue19dateoctober11879page289url httpwwwsidneyrigdoncomdbroadhu |
|||
| {{Citation |
|||
ilsain1872htm100179precitation |
|||
| last = Turner |
|||
lastsmithfirstjoseph |
|||
| first = Orsamus |
|||
authorlinkjosephsmith |
|||
| title = History of the pioneer settlement of Phelps and Gorham's purchase, and Morris' reserve |
|||
titlelast testimony sister emma |
|||
| publisher = William Alling |
|||
newspaperthesaintsheraldlocationplanovolume26issue19dateoctober 1879page289url httpwwwsidneyrigdoncomdbroadhuilsain1872htm100179conference papers and public lecturesclasswikitable |
|||
| place = Rochester, New York |
|||
conference paperprecitation |
|||
| year = 1851 |
|||
lastsullivanfirstdb |
|||
| ol = 7120924W |
|||
contributiontime and frequency measurementatnistthe first 100 yearsyear2001title2001 ieee int'l frequency controlsymppublishernational institutestandards and technologycontributionurl httptfnistgovtimefreqgeneralpd1485pdprecitationlastsullivanfirst dbcontributiontime and frequency measurement at nistthe first 100 yearsyear2001title 2001 ieeeintfrequency control symppublishernational institute standards and technology |
|||
}} |
|||
contributionurl httptfnistgovtimefreqgeneralpd1485pdlectureprecitationlast habichtfirstchristiancontribution hellenisticathens and her philosophersyear1988titledavid magie lectureprinceton university program in the historyarchaeology and religionsthe ancientworldpublisher princeton universitpagepre |
|||
|} |
|||
citationlasthabichtfirst christiancontributionhellenistic athens and her philosophers |
|||
year1988titledavidmagielecture princeton university program in the historyarchaeologyand religionsthe ancient worldpublisherprinceton universitypagepartsbooksincluding encyclopedia articlesclasswikitable |
|||
==Full citation parameters== |
|||
manuscript published in an edited compilationprecitationlastbidamonfirst emma smithauthorlinkemma Hale smithchapterletter to emma s pilgrimdatemarch 271876editorlast vogeleditorfirstdantitle early mormon documentsvolumepublisher signature vooks |
|||
{{notice|This section needs to be edited. It includes deprecated parameters and does not include parameters that were added in the updates.}} |
|||
publicationdate 1996 |
|||
These can be used for all types of publication. All are optional and indentation is used simply to group related items — these may be mutually exclusive where indicated. Some hyphenated names can also be placed without hyphens. |
|||
isbn1560850728precitationlast bidamonfirst emma smithauthorlinkemma hale smithchapterletter to emma s pilgrimdate march 271876editorlast vogeleditorfirstdantitleearly mormon documentsvolumepublishersignaturebookspublicationdate1996isbn 1560850728work with an editor but no authorprecitationeditorlast vogeleditorfirstdantitleearly mormon documentsvolume publishersignature booksdate1996 |
|||
isbn 1560850728precitationeditorlast vogeleditorfirstdantitle early mormon documentsvolumepublisher signature vooksdate1996isbn1560850728 |
|||
{| class="wikitable" |
|||
encyclopedia article by a named authorprecitationlastkramerfirst martinauthorlink martinkramer |
|||
|- |
|||
year1999titlebernard lewiseditorlastboydeditorfirst kelleyencyclopediaencyclopedia historians and historical writingvolumepages 719720location london |
|||
| <pre>{{Citation |
|||
publisherfitzroydearbornurhttpwwwgeocitiescommartinkramerorgbernardlewishtmprecitationlastkramerfirst martinauthorlinkmartinkrameryear 1999titlebernard lewiseditorlast boydeditorfirstkelleyencyclopediaencyclopedia historians and historical writing |
|||
| author = |
|||
volume pages 719720 |
|||
| last = |
|||
location londonpublisherfitzroy dearbornurl httpwwwgeocitiescommartinkramerorgvernardlewishtm |
|||
| first = |
|||
encyclopediaarticle with no named authorprecitation |
|||
| author2 = |
|||
titlebernardlewiseditorlast boyeditorfirstKelleyyear 1999 |
|||
| last2 = |
|||
encyclopediaencyclopediahistorians |
|||
| first2 = |
|||
and historicalwritingvolumepages 719720 |
|||
| author-link = |
|||
publisherfitzroy dearborn |
|||
| author2-link = |
|||
locationlondonurl httpwwwgeocitiescommartinkramerorgvernardLewishtmprecitation |
|||
| author-separator = |
|||
title vernard lewis |
|||
| author-name-separator = |
|||
editorlast boyd |
|||
| author-mask = |
|||
editorfirst kelleyyear 1999encyclopedia encyclopedia historians and historical Writing |
|||
| display-authors = |
|||
volume |
|||
| editor = |
|||
pages719720location london |
|||
| editor-last = |
|||
publisherfitzroydearborn |
|||
| editor-first = |
|||
urlhttpwwwgeocitiescommartinkramerorgvernardLewishtmrepublications or edited quotations in a periodical articleclasswikitablemanuscript edited and published in a journal |
|||
| editor2 = |
|||
precitationlastknight |
|||
| editor2-last = |
|||
first josepsryear1833editorlast jesseeeditorfirst deantitle joseph knights recollectionEarly Mormon history |
|||
| editor2-first = |
|||
journalbyustudies |
|||
| editor-link = |
|||
volume 17issuepublicationdate1976 |
|||
| editor2-link = |
|||
page35 |
|||
| translator-last = |
|||
urlhttpbyustudiesbyuedushoppdfsrcjesseepdprecitationlastknightfirst josephsryear1833editorlast Jesseeeditorfirst dean |
|||
| translator-first = |
|||
titlejoseph knights recollection early mormonhistory |
|||
| translator-link = |
|||
journalbyustudiesvolumeissue |
|||
| translator2-last = |
|||
publicationdate1976page 35urlhttpbyustudiesbyuedushopdfsrc17jesseepdf manuscript written at one date and placethen published in a periodical at a different date and place with commentary by the editorprecitation |
|||
| translator2-first = |
|||
lastklingensmithfirst philip |
|||
| translator2-link = |
|||
type affidavit |
|||
| others = |
|||
date september 5 1872 |
|||
| publication-date = |
|||
place lincoln countynevadatitle mountain meadows massacreeditorlast toohyeditorfirstdennis jjournal corinne aaily reporterpublicationdate september 241872publicationplace corinne utah |
|||
| date = |
|||
volume issue252 pageurlhttpudnlibutaheduucorinne5359prcitationlastklingensmithfirstphiliptype affidavitdateseptember1872 |
|||
| year = |
|||
place lincoln county nevada |
|||
| origyear = |
|||
title mountain meadows massacre |
|||
editorlast toohyeditorfirst dennisj |
|||
| chapter = |
|||
journalcorinne daily reporter |
|||
| chapter-url = |
|||
publicationdateseptember 24 1872publicationplacecorinneutah |
|||
| chapter-format = |
|||
volumeissue252pageurl http:udnlibutaheduucorinne5359press releaseclasswikitable |
|||
| contribution = |
|||
press release with quotation |
|||
| contribution-url = |
|||
precitatio urlhttpwwwapplecomprlibrary20100405padhtmtitleapple sells over 300,000 ipads first day |
|||
| type = |
|||
publisherappleincaccessdateapril 2010quotein the us asmidnight saturdayaprilrefnonepre |
|||
| journal = |
|||
citationurl httpwwwapplecomprlibrary201004ipadhtmltitleapplesells over 300,000 ipadsdirstday |
|||
| periodical = |
|||
publisherappleincaccessdate april 102010 |
|||
| newspaper = |
|||
quotein the us asmidnight aturdayaprilrefnoneanchored citations |
|||
| magazine = |
|||
thistemplate can generate a citation that can be combined with wpciteshortshortened footnotesorwikipediaparenthetical referencingparenthetical referencing it does this by creating an htnl element anchorhtml anchorcontaining an id the special parameterpara refharvgenerates ansuitable for harvard referencingtemplates such astlharvas specified in the next sectionthis is the default for the tlcitationtem plateto disable anchor generationspecifypararefnone you can also specify the r directly using thepararefvarvarparameterfor examplesuppose an article's referencessection contains the markupcodenowikicitationauthorsigmund freud titlecivilization and Its Discontentsdate1930refcivdisnowikicode |
|||
| encyclopedia = |
|||
which generates the citationcitationauthorsigmund freudtitlecivilization and its discontentsdate1930refcivdis |
|||
| work = |
|||
thenthe markupcodenowikicivdisfreud 1930nowikicode generates a parenthetical reference civdisfreud 1930containing a wikilink to the citationtry clicking on the wikilink |
|||
| edition = |
|||
anchors forharvard referencing templates |
|||
| series = |
|||
ids compatible with Harvard referencing templates such as tlharvare compute from the last names the authorsor editorsif no authors are givenand the yearthe cited source for examplethe markupcodenowikiharvwrightevans1851pix nowikicodegenerates the harvard referenceharvwrightevans1851pixwhich wikilinks to the citation whose markup and appearance are shown belowcodenowikicitationlastwrightfirstthomaslastevansfirstrhtitlehistorical and descriptive accountthe caricaturesjames gillraylocationlondonpublisherhenry gbohndate1851 oclc59510372nowikicodecitationlastwrightfirstthomaslastevansfirstrhtitlehistorical and descriptive account the caricaturesjames gillraylocationlondonpublisher=Henry gbohndate1851oclc=59510372 |
|||
| volume = |
|||
In this example thetlcitation template definesand thetlharvtemplate uses the html idcodeciteref wrightEvans1851code composed by concatenating the stringcodeciterefcodewith the last namesthe authors and the yearthe tlharvidtemplate can be used to generate such idsfor examplecodenowikiharvidwrightevans1851nowikicode generatescodeharvidwrightevanscode |
|||
| issue = |
|||
related methods which leave only a number in the text are to use the tlharvnbtemplate enclosed in the nowikirefrefnowikihtml codeor to use thetlsfntemplate alonethe example above would be codenowikirefharvnbwrightevans1851p=ixrefnowikicodeorcodenowiksfnwrightevans1851pixnowikicode both which generate a foot such as17harvnbwrightevans1851pix |
|||
| publisher = |
|||
the names only the first four authors are usedother author names are not concatenated to theif no author names are giveneditor names are used instead |
|||
| publication-place = |
|||
last names are usedas specified by the parametersparalastor paralastparalastparalastand paralastand similarly for paraeditorlastetcand for parainventorlastetcif a full name is given but no last name is specified, this template falls back on the full namebut this usage is not recommendedfor exampleincodenowikicitationauthorsigmund freudtitlethe ego and the iddate1923nowikicodeno last name is givenso this citation cannot be combined with the harvard reference codenowikiharvdreud1923nowikicode to make thesetlcitationand tlharvinvocations compatibleeither replaceparaauthorsigmundfreudwithparafirstsigmundparalastfreudor add pararefnowikiharvidfreud1923nowikito thetlcitationinvocationor add the same ref parametersaypararefegoIdto both the tlcitationand the tlharvinvocationsthis paragraph appears to be outdated and probably needs to be updated to reflect currentcscsfunctionalitysimilarlythe year is usedas specified byparayearif no year is given this template attempts to derive the year fromparadateorif no date is givenfrom parapublicationdate by applying themwhelpextensionparserfunctionstimenediaWikinbsptimefunctionthis heuristic works with most common date formatsamericaninternational andiso8601calendar datesiso8601 standard formatas listed in wpmosbut may not work as expected with other formatsso when in doubt it may be safer to use parayear |
|||
| place = |
|||
ids must be unique |
|||
| language = |
|||
Namesyearsand handspecified ids must be chosen so that the ids are unique within a pageotherwise the html will not conform to the wc standardsand any references to the citations will not work reliablyfor examplesuppose a page contains the following two citations withtlharvcompatibleids: |
|||
| page = |
|||
citationlastmontesfirstglasthaltermanfirstjsdate2008ajournalpediatricsvolumeissuepagese821e826titleassociationchildhoodautismspectrumdisorders and Lossfamily incomedoi101542peds20071594pmid18381511urlhttppediatricsaappublicationsorgcgicontentfull1214e821citationlastmontefirstlasthaltermanfirstjsdate2008bjournapediatricsvolume122issue=1pagese202e208titlechild care problems and employment among families with preschoolagedchildren with Autism in the united statesdoi101542peds20073037pmid18595965urlhttppediatricsaappublicationsorgcgicontentfull1221e202ifthese citations were altered to say2008 rather than2008aand2008bthe resulting page would not workbecause the two different citations would both attempt to use the idcodecitwrefnonteshalterman2008codeto avoid this problemdistinguish the citations by appending suffixes to the yearsegparadate2008aand paradate2008b as was done aboveany harvard references to these citations should use years with the same suffixesit is good practice to verify that a page does not contain duplicateids by usingthew3cmarkup validationserviceseeexternal linksexternallinksdates |
|||
| pages = |
|||
reflistgroupnrefsref namedatesgroupnthe formatf dates in the referencesan article should use consistent and unambiguous stylesexample formats used in Wikipediacitations include200920090914iso8601calendar datesiso8601standard format |
|||
| nopp = |
|||
september2009septemberwith comma |
|||
| at = |
|||
septemberdates should not be linked sayto a wikipedia article the same name in referencesplease seeWikipediamanualstyledates and numbersdateswikipediananualstyle dates and numbersnbspdatesfor more guidanceformatting datesref |
|||
| id = |
|||
tools |
|||
| isbn = |
|||
seewikipediaxiting sourcescitation templates and toolswikipediaciting sourcesnbspcitation templates and toolsfor a list tools that can help create a reference in thecitationformattemplatedata |
|||
| issn = |
|||
noticethis template data section needs to be edite dit includes deprecated parameters and does not include parameters that were added intheluaupdatestemplatedata headertemplatedatdescriptionthe citation template generates a citation for a bookperiodicalcontribution in a collective workor a web pageit determines the citation type by examining which parameters are useparamslastlabellastnamedescriptionthe surnamethe author don't wikilinkuseauthorlinkinsteadcan suffix with a numeral to add additional authorsaliasesauthoauthorlasttypelinesuggestedtruefirstlabelfirst namedescriptionfiven or first name middle namesor initialsthe authordon't wikilinkuseauthorlinkinsteadcan suffix with a numeral to add additional authorsaliasesfirsttypelinesuggestetruetitlelabeltitlsourcetypestrindescriptiontitlesourceworks display in italics and articles surrounded in quotation marksrequiredtruedate |
|||
| oclc = |
|||
labeldate sourcetypestringdescriptionfull datesource being referenced in the same format as other publication dates in the citations do ot wikilinkdisplays after the authors and enclosed in parenthesesif there is no authorthen displays after publisherurllabelurk sourcetypestrindescriptionurl an onlinelocation where the textthe publication can be foundpublicationdatelabelpublication datetypestringrequireddescription datepublication when different from the date the work was written. Displays only ifyear or date are defined and only if differentelse publicationdate is used and displayed as dateuse the same format as other dates in the articledo ot wikilinkfollows publisherif work is not definedthen publication-date is preceded bypublished and enclosed in parenthesisdflabeldatedormadescriptionsets rendered datesto the specified formattypestringyearlabeltear publicationdescriptionyear the source being referencedrecommended only when date parameter format is yymd and a citerefmbiguator is neededtypenumberpostscriptlabelpostscripttypestringrequireddescriptioncontrols the closing punctuation for a citationdefaults to a period for no terminating punctuation specifypostscriptnone leavingpostscriptempty is the same as omitting itbut is ambiguousignored if quote is definedauthormasklabelauthor masktypestringrequiredaliases authormaskdescriptionreplaces the name the first author with em dashes or textset authormask to a numeric value n to set the dash n em spaces wideset author mask to a text value to display the text without a trailing author separatorfor examplewithyou must still include the values for all authors for metadata purposesprimarily intended for use with bibliographies or bibliography styles where multiple works by a single author are listed sequentially such as shortened footnotesdotuse in a list generated by reflistreferencesor similar as there is no controlthe order in which references are displayedyou can also use editormask and translatormask in the same waylastlabellast namdescriptionthe surnamethe second authordontwikilinkuseauthorlink insteadaliasesauthorsurnametypelinefirslabelfirst namedescriptiongiven or first name middle namesor initialsthe second authordon't wikilinktypelinealiasesgivelaslabellast namedescriptionthe surnamethe third authordon't wikilinkuseauthorlinkinsteaaliasesauthorsurnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe third authordon't wikilinktypelinealiasesgivenlas labellastnamedescriptionthe surnamethe forth authordon't wikilinkuseauthorlinkinsteadaliases |
|||
| pmid = |
|||
authorsurnametypelinefirstlabelfirst name descriptiongiven orfirst name middle names or initialsthe forth authordon't wikilinktypelinealiases |
|||
| pmc = |
|||
givenlaslabellast name descriptionthe surnamethe fifth authordon't wikilink use authorlinkinsteadaliasesauthor surnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe fifth authordont wikilintype linealiases givenlastlabellast namedescriptionthe surname the sixth author don't wikilinkuse authorlinkinsteadaliasesauthorsurnametypelinefirstlabelfirst name descriptiongiven or first name middle namesor initialsthe sixth authordon't wikilinktypelinelastlabellast name descriptionthe surname the seventh author don't wikilinkuse authorlink'insteadaliasesauthorsurnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe seventh authordon't wikilink |
|||
| bibcode = |
|||
typelinealiasesgivenlastlabellast name descriptionthe surname the eighth authordon't wikilinkuse authorlink' insteadaliasesauthorsurnametypelinefirslabelfirst name descriptiongiven or first name, middle namesor initials the eighth author dont wikilinktypelinealiasesgivenlastlabellast namedescriptionthe surnamethe ninth authordont wikilinkuseauthorlinkinsteadif nine authors are definedthen only eight will show and et alwill show in place the last authoraliasesauthorsurnametypelinefirslabelfirst namedescriptiongiven or first name middle names or initials the ninth authordont wikilinktype": linealiasesgivenauthor-linklabelauthor linkdescriptiontitleexisting Wikipedia article about the author can suffix with a numeral to add additional authorstypewikipagenamealiasesauthorlinkauthorlinkauthorlinkauthorlinlabelauthor link descriptiontitle existing Wikipedia articlethe second authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabel author link descriptiontitle existing wikipedia article about the third authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabelauthor linkdescriptiontitle existing wikipedia article about the forth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinlabelauthor linkdescriptiontitle existing wikipedia articlethe sixth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinlabelauthor linkdescriptiontitle existing Wikipedia article about the sixth authortypewikipagenamealiasesauthorlinkauthorlinkautholinklabelauthorlinkdescriptiontitle existing Wikipedia articlethe seventh authortypewikipagenamealiasesautholinkauthorlinkauthorlinklabelauthor lindescriptiontitle existing Wikipedia article about the eighth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabelauthor lindescriptiontitle existing Wikipedia articlethe ninth authortypewikipagenamealiasesautholinkauthorlinorigyearlabeloriginal yeadescriptionoriginal year publicationprovide specificstypenumberaliasesorigyeartranstitlelabeltranslated titledescriptionan english language titleif the source cited is in a foreign languagelanguage is recommendedtypecontenttranschapterlabeltranslated chapter titledescription an English language chapter title if the source cited is in a foreign languagelanguageis recommendedtypecontenttypelabeltypedescriptionadditional information the media typethe sourceformat in sentence casetypecontentarchiveurllabelarchive urldescriptionthe url an archived copy a web pageif or in case the URL becomes unavailablerequiresarchivedatetypelinealiasesarchiveurlserieskabelseriesdescriptionseries identifier when the source is part a seriessuch as a book series or a journalaliasversiontypecontentaliasesversionworklabelworkdescriptionname the work in which the cited title is foundtypestringaliasesjournalwebsitenewspapermagazineencyclopediaencyclopaediadictionarymailinglistperiodicalvolumelabelvolumedescriptionfor one publication published in several volumestypelinesuggestedtrueissuelabel issuedescriptionissue numbertypestringaliasesnumberpagelabelpagedescriptionpage in the source that supports the contentdisplaysafterptypelinepages |
|||
| doi = |
|||
labelpagesdescriptionpages in the source that support the contentot an indication the number pages in the source; displays afterpptypelinesuggestedtrue |
|||
| doi-inactive-date= |
|||
labelatdescriptionmay be used insteadpageopageswhere a page number is inappropriate or insufficienttypelinenopplabeldescriptionset toyto suppress thepor ppdisplay with pageor pages when inappropriatesuch asfront cover |
|||
| zbl = |
|||
typelinechapterlabelchapterdescriptionthe chapter heading the sourcetypestring contributionlabelcontributiontypestringrequiredchapterurllabelchapterurltypestringrequiredaliaseschapterurcontributionurllabelcontributionurltypestringrequired |
|||
| url = |
|||
chapterformatlabelchapterformattypestringrequiredotherslabelotherstypestringrequireddescriptionFreetext field for people involved in creating a work who cannot be added with another name parameter such as author or editoreditionlabeledition |
|||
| access-date = |
|||
descriptionWhen the publication has more than one edition for examplendrevisedetcsuffixed with edtypelineplacelabellocation publication descriptiongeographical place publicationusually not wikilinkedtypestringaliaseslocationpublicationplacelabelplacepublicationdescriptionpublication place shows after titleifplace orlocation are also given they are displayed before the title prefixed withwritten attypecontentpublisher |
|||
| format = |
|||
labelpublisherdescriptionname the publisherdisplays after titletypecontentlanguagelabellanguagedescriptionthe language in which the source is writtenif nt english use the full language namedo not use icons or templatestypecontent |
|||
| archive-url = |
|||
formatlabelformatdescriptionformat the work referred to byurlurlis required when usingformat examplespdfdocxlsdo not specify hTmLtypecontentarxivlabelarXiv identifierdescriptionan identifier for arXive electronic preprintsscientific paperstypelineasinlabelasundescriptionamazonstandard identificationnumber characterstypelinealiasesasinasintld |
|||
| archive-date = |
|||
labelasintlddescript toplevel domain foramazon sites other than theustypelinebibcodelabelbibcode |
|||
| url-status = |
|||
descriptionvibliographicreference code refcodecharacterstypelinebiorxiv |
|||
| quote = |
|||
labelbiorxivdescriptionbiorxiv identifierdigitstypelineciteseerxlabelciteseerxdescriptionciteseerx identifierfound after thedoiquery parametertypelinedoilabeldoidescriptiondigital object identifierbegins withtypestringaliasesdoibrokendatelabeldoi broken datedescriptionthe date that the doi was determined to be brokentypedateisbnlabelisbndescriptioninternationalstandard book bumberuse thedigitwhere possibletypeline |
|||
| layurl = |
|||
issnlabelissndescriptioninternationalstandardserialnumberprint charactersusually split into two groupsfour using a hyphentypelineeissnlabeleissndescriptioninternational standard serialnumberonline charactersusually split into two groups four using a hyphentypelinejfmlabeljfm codedescriptionjahrbuchuber die fortschritte der mathematik classification codetypelinejstorlabeljstordescriptionjstor identifiertypelinelccnlabellccndescriptionlibrary congress control numbertypelinemrlabelmrdescriptionmathematical reviews identifiertypelineoclclabeloclcdescriptiononlinecomputelibrary center numbertypenumberollabeloLdescriptionopen library identifiertypelineosti |
|||
| laysource = |
|||
labelostIdescriptionofficescientific and Technical Information identifiertypelinepmclabelpmcdescriptionpubmedcenter article numbertypenumberpmidlabelpmiddescriptionPubmed unique Identifiertypelinerfclabelrfcdescriptionrequest for com ments numbertypenumberssrnlabelssrndescriptionsocial scienceresearch networktypelinezbllabelzb descriptionzentralblatt math journal identifietypelineidlabeliddescription unique identifier used where none the specialized ones are applicabletypelinequotelabelquotedescriptionrelevant text quoted from the source displays last enclosed in quotesneeds to include terminating punctuationtypecontentreflabelrefdescriptionan anchor identifiercan be made the target wikilinks to full referencesspecial value harv generates an anchor suitable for the harv and sfn templatestypelineaccessdatelabelur access datedescriptionthe full date when the original url was accessed do not wikilinktypedatealiasesaccessdatelaysourcelabellay sourcedescriptionname the source the laysummarydisplays in italics preceded by an en dashtypestringaliaseslaysourcelaydatelabellay datedescriptiondatthe summarydisplays in parenthesestypedatealiaseslaydatearchivedatelabelarchive datedescriptiondate when the original url was archived do not wikilinktypedatealiasesarchivedateeditorlastlabeleditor last namedescriptionthe surname the editordont wikilink use editorlink can suffix with a numeral to add additional editoaliaseseditoreditorsurnameeditorlasteditorsurnameeditoreditorlasteditorsurnameeditorseditorfirstlabeleditor first namedescriptionthe surnamethe editordont wikilinkuse editorlinkcan suffix with a numeral to add additional editorsaliaseseditorfirsteditorgiven |
|||
| laydate = |
|||
editorfirsteditorgiveneditorlastlabeleditor last name descriptionthe surnamethe second editordon't wikilinkuseeditorlinkeditor first namedescriptiongiven or first name, middle names or initials the second editordont wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last name descriptionthe surname the third editor don't wikilinkuseeditolinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven orfirst name middle names or initialsthe third editordon't wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last namedescriptionthe surnamethe fourth editordon't wikilinkuseeditorlinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven or first name middle names or initialsthe fourth editordont wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last namedescriptionthe surname the fifth editor don't wikilink use editolinkaliaseeditortypelineeditofirslabeleditor first namedescriptiongiven or first name middle names or initialsthe fifth editordont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surnamethe sixth editondon't wikilinkuse editorlinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven or first name middle names or initialsthe sixth editordont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surname the seventh editordont wikilinkuse editorlinkaliaseseditortypelineeditorfirstlabeleditor first name descriptiongiven or first name middle names or initialsthe seventh editor dont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last namedescriptionthe surnamethe eighth editordont wikilinkuseeditorlinkaliaseseditortypelineeditofirstlabeleditor first namdescriptiongiven or first namemiddle namesor initialsthe eighth editordon't wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surnamethe ninth editor dont wikilink useeditorlinkaliaseseditortypelineeditorfirstlabeleditor first name descriptiongiven or first name middle namesor initials the ninth editordont wikilinktypelinealiaseseditorgiveneditorlinklabeleditorlinktypestringrequirededitolink |
|||
| separator = |
|||
labeleditorlinktypestringrequired |
|||
| postscript = |
|||
editorlinklabeleditorlinktypestringrequirededitolinklabeleditorlinktypestringrequirededitolinklabeleditorlinktypestringrequiredtranslatorlastlabeltranslator last name descriptionthe surnamethe translatodont wikilink usetranslatorlinkcan suffix with a numeral to add additional translatorsaliasestranslatortranslatorlastranslatortranslatorlasttypestringtranslatorfirstlabeltranslator first namedescriptiongiven or first name, middle namesorinitialsthe translatordont wikilinkuse translatorlinkcan suffix with a numeral to add additional translatorsaliasestranslatorfirsttranslatorfirst1typestringtranslatorlinklabeltranslator linkdescriptiontitle existing Wikipedia article about the translatorcan suffix with a numeral to add additional translatorstypewikipagenamealiasestranslatorlinktranslatorlinktranslatorlaslabeltranslator last namedescriptionthe surnamethe second translatordont wikilinkusetranslatorlinkaliasestranslatortranslatorlasttype stringtranslatorfirslabeltranslator first namdescriptiongiven or first name middle namesor initials the second translatordon't wikilinkuse translatorlinkaliasestranslatorfirsttypestringtranslatorlast labeltranslator last namdescriptionthe surnamethe third translatordont wikilink use translatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirstlabeltranslator firstname,descriptiongiven or first name,middle namesor initialsthe third translator dont wikilinkusetranslatorlinkaliases translatorfirsttypestringtranslatorastranslator last name descriptionthe surnamethe fourth translatordont wikilinkuse translatorlinkaliasestranslatortranslatorlast |
|||
| ref = |
|||
typestringtranslatorfirstlabeltranslatorfirst namedescriptiongiven or first namemiddle namesor initials the fourth translatordon't wikilinkuse translatorlinaliasestranslatorfirsttypestringtranslatorlastlabeltranslator last namedescriptionthe surname the fifth translatordont wikilinkusetranslatorlinkaliasestranslatortranslatorlaststringtranslatorfirslabeltranslator first name descriptiongiven or first namemiddle namesor initials the fifth translatordont wikilink use translatorlinkaliasestranslatorfirsttypestringtranslatorlaslabeltranslator last namedescriptionthe surnamethe sixth translatordon't wikilinkusetranslatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirslabeltranslator first namedescriptiongiven or first name middle namesor initialsthe sixth translatordont wikilinkuse translatorlinkaliasestranslatofirsttypestringtranslatorlastlabeltranslator last namedescriptionthe surnamethe seventh translatordon't wikilinkusetranslatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirslabel translator firstnamedescriptiongiven or first name middle namesor initialsthe seventh translatordont wikilinkusetranslatorlinkaliasestranslatorfirsttypestringtranslatorlalabeltranslatorlast namedescriptionthe surname the eighth translatordont wikilinkusetranslatorlinkaliases |
|||
}} |
|||
translatortranslatorlasttypestringtranslatorfirslabeltranslator first namedescriptiongiven or first name middle namesorinitialsthe eighth translatordont wikilink use translatorlinkaliasestranslatorfirsttypestringtranslatorlaslabeltranslatorlast name descriptionthe surname the ninth translatordon't wikilinkuse translatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirst: labeltranslator first namdescriptiongiven or first name middle names or initials the ninth translatordon't wikilinkusetranslatorlinkaliasestranslatorfirsttypestringtranslatorlinklabeltranslatorlink descriptiontitleexisting Wikipedia articlethe second translator |
|||
</pre> |
|||
typewikipagenamealiasestranslatorlinktranslatorlinlabeltranslator linkdescriptiontitleexisting Wikipedia articlethe third translatortypewikipagenamealiasestranslatorlinktranslatorlinlabeltranslatorlinkdescriptiontitleexisting Wikipedia article aboutthe fourth translatortypewikipagename |
|||
|} |
|||
aliasestranslatorlinktranslatorlinlabektranslator linkdescriptiontitleexistingwikipedia article about the fifth translatortypepagenamealiasestranslatorlinktranslatorlinlabeltranslator linkdescriptiontitleexisting Wikipedia articlethe sixth translatortypewikipagenamealiasestranslatolinktranslatorlinlabeltranslator linkdescriptiontitleexistingarticlethe seventh translatortypepagenamealiasestranslatolinktranslatorlinlabeltranslatorinkdescriptiontitle existing Wikipedia article about the eighth translatortypepagenamealiasestranslatolinklinlabellindescriptiontitle existing Wikipedia article about the ninth translatortypewikipagenamealiases translatorinklayurlaliases layurllabellay urldescriptionurllink to a nontechnical summary or review the sourcetypelinedisplayauthorlabeldisplay authorsdescriptionnumber authors to display beforeet alis used must be less than the number listedtypenumbernameliststylealiases namelistformatlabelbame list styledescriptionsets the style for the listacceptsampandandvanc amp displays an ampersand after the penultimate nameand the same withand and vanc displays in Vancouver formattypestringmapscitoid editioneditiontitletitlecasenametitlenameacttitleurlurllabelpublishercompanypublisherstudiopublishernetworkpublisherdistributorpublisherpublisherpublisherpublicationtitleworkdictionarytitleworkencyclopediatitleworkbooktitleworkdatedatedateenacteddatedateDecideddateaccessdateaccessdateplaceplace issndoidoilanguagelanguagepodcastercontributorothersauthorfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlasttranslatortranslatorfirsttranslatorlasttranslatorfirsttranslatorlastranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirst translatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlastranslatorfirsttranslatorlasteditoreditorfirsteditorlasteditofirsteditolasteditofirsteditolasteditofirsteditolastparamorderlastfirsttitledateurlworkvolume |
|||
issuepagepagespublicationdatedfyearpostscripteditorlasteditorfirst |
|||
==Parameters== |
|||
authormaskorigyeartranstitletranschaptertypearchiveurlseriesat |
|||
===Syntax=== |
|||
noppchaptercontributionchapterurlcontributionurlchaptertotherseditionplacepublicationplacepublisherlanguageformatarxivasinasintldbibcodebiorxivciteseerxdoidoibrokendateisbnissneissnjfmjstorlccnmroclcolostipmcpmidrfc |
|||
{{csdoc|syntax|lua=yes}} |
|||
ssrnzblidquoterefaccessdatelayurlaysourcelaydatenameliststyledisplayauthorsarchivedatelastfirslasfirslasfirstlastfirstlast |
|||
firslasfirslasfirslasfirsauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkeditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlinkeditorlinkeditorlinkeditorlinkeditorlinktranslatorlasttranslatorfirsttranslatorlinktranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatolasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlinklinktranslatorlinktranslatorlinktranslatorlinktranslatorlinktranslatorlinktranslatorlitemplatedata |
|||
{{csdoc|sep_comma|lua=yes}} |
|||
cosee alsowikipediacitation templateswikipediainline citationwikipediaparenthetical referencing |
|||
foracomparisoncitations using templates withcitations written freehandseewikipediaciting sourcesexample edits for different methodsfootnoteswikipediaciting sourcesexample edits for different methodsnbspdootnotes botesreflist |
|||
===COinS=== |
|||
wikipedia referencingwikipedia help pages |
|||
{{csdoc|coins|lua=yes}} |
|||
includeonlysandbox other categories go below thislinepleaseinterwikis go to Wikidatathank youcategorycitation styletemplatesincludeonly |
|||
===What's new=== |
|||
{{csdoc|whats new}} |
|||
===Deprecated=== |
|||
{{csdoc|deprecated|lua=yes}} |
|||
===Description=== |
|||
====Authors==== |
|||
{{csdoc|author|lua=yes||contributor=yes|others=yes}} |
|||
====Editors==== |
|||
{{csdoc|editor|lua=yes}} |
|||
====Title==== |
|||
{{csdoc|title|lua=yes|title_format=italics}} |
|||
{{csdoc|chapter|lua=yes}} |
|||
{{csdoc|type|lua=yes}} |
|||
{{csdoc|language|lua=yes}} |
|||
====Date==== |
|||
{{csdoc|date|lua=yes}} |
|||
====Work==== |
|||
{{csdoc|journal|lua=yes}} |
|||
====Publisher==== |
|||
{{csdoc|publisher|lua=yes}} |
|||
====Edition, series, volume==== |
|||
{{csdoc|edition|lua=yes}} |
|||
{{csdoc|series|lua=yes}} |
|||
{{csdoc|volume|lua=yes}} |
|||
====In-source locations==== |
|||
{{csdoc|pages|lua=yes}} |
|||
====URL==== |
|||
{{anchor|url}}{{csdoc|url}} |
|||
====Chapter URL==== |
|||
{{anchor|chapterurl}}{{csdoc|chapterurl|lua=yes}} |
|||
====Anchor==== |
|||
{{csdoc|ref|lua=yes}} |
|||
====Identifiers==== |
|||
{{anchor|id1}}{{csdoc|id1|lua=yes}} |
|||
{{anchor|id2}}{{csdoc|id2|lua=yes}} |
|||
====Quote==== |
|||
{{csdoc|quote|lua=yes|cs2=yes}} |
|||
====Laysummary==== |
|||
{{csdoc|lay|lua=yes}} |
|||
====Display options==== |
|||
{{csdoc|display|lua=yes|cs2=yes}} |
|||
====Subscription or registration required==== |
|||
{{csdoc|registration|lua=yes}} |
|||
==Examples== |
|||
===Books=== |
|||
{| class="wikitable" |
|||
|- |
|||
| Three authors, a volume, and an edition. Ampersand (&) forced before final author's name. |
|||
| <pre>{{Citation |
|||
| last1 = Lincoln |
|||
| first1 = A. |
|||
| last2 = Washington |
|||
| first2 = G. |
|||
| last3 = Adams |
|||
| first3 = J. |
|||
| name-list-style = amp |
|||
| title = All the Presidents' Names |
|||
| publisher = The Pentagon |
|||
| place = Home Base, New York |
|||
| volume = XII |
|||
| edition = 2nd |
|||
| year = 2007 |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| last1 = Lincoln |
|||
| first1 = A. |
|||
| last2 = Washington |
|||
| first2 = G. |
|||
| last3 = Adams |
|||
| first3 = J. |
|||
| name-list-style = amp |
|||
| title = All the Presidents' Names |
|||
| publisher = The Pentagon |
|||
| place = Home Base, New York |
|||
| volume = XII |
|||
| edition = 2nd |
|||
| year = 2007 |
|||
}} |
|||
|} |
|||
===Web=== |
|||
{| class="wikitable" |
|||
|- |
|||
| Web page |
|||
| <pre>{{Citation |
|||
| url = http://nrhp.focus.nps.gov/ |
|||
| title = NPS Focus |
|||
| work = National Register of Historic Places |
|||
| publisher = [[National Park Service]] |
|||
| access-date = November 30, 2010 |
|||
| ref = none |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| url = http://nrhp.focus.nps.gov/ |
|||
| title = NPS Focus |
|||
| work = National Register of Historic Places |
|||
| publisher = [[National Park Service]] |
|||
| access-date = November 30, 2010 |
|||
| ref = none |
|||
}} |
|||
|- |
|||
| Archived page |
|||
| <pre>{{Citation |
|||
| url = http://liftoff.msfc.nasa.gov/academy/space/atmosphere.html |
|||
| title = Earth's Atmosphere |
|||
| access-date = October 25, 2007 |
|||
| publisher = [[National Aeronautics and Space Administration]] |
|||
| year = 1995 |
|||
| author = NASA |
|||
| archive-url = https://web.archive.org/web/20071013232332/http:// |
|||
liftoff.msfc.nasa.gov/academy/space/atmosphere.html |
|||
| archive-date = October 13, 2007 |
|||
}} |
|||
</pre> |
|||
| {{Citation | url = http://liftoff.msfc.nasa.gov/academy/space/atmosphere.html | title = Earth's Atmosphere | access-date = October 25, 2007 | publisher = [[National Aeronautics and Space Administration]] | year = 1995 | author = NASA | archive-url = https://web.archive.org/web/20071013232332/http://liftoff.msfc.nasa.gov/academy/space/atmosphere.html | archive-date = October 13, 2007}} |
|||
|} |
|||
===Journals, newspapers, magazines, or other periodicals=== |
|||
{| class="wikitable" |
|||
|- |
|||
| Journal article |
|||
| <pre>{{Citation |
|||
| last = Hill |
|||
| first = Marvin S. |
|||
| title = Joseph Smith and the 1826 |
|||
Trial: New Evidence and New |
|||
Difficulties |
|||
| journal = BYU Studies |
|||
| volume = 12 |
|||
| issue = 2 |
|||
| year = 1976 |
|||
| pages = 1–8 |
|||
| url = https://byustudies.byu.edu/shop/PDFSRC/12.2Hill.pdf |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| last = Hill |
|||
| first = Marvin S. |
|||
| title = Joseph Smith and the 1826 Trial: New Evidence and New Difficulties |
|||
| journal = BYU Studies |
|||
| volume = 12 |
|||
| issue = 2 |
|||
| year = 1976 |
|||
| pages = 1–8 |
|||
| url = https://byustudies.byu.edu/shop/PDFSRC/12.2Hill.pdf |
|||
}} |
|||
|- |
|||
| Journal article with multiple authors and identifier |
|||
| <pre>{{Citation |
|||
| last1 = Mandelkern |
|||
| first1 = M |
|||
| last2 = Elias |
|||
| first2 = J |
|||
| last3 = Eden |
|||
| first3 = D |
|||
| last4 = Crothers |
|||
| first4 = D |
|||
| display-authors = 2 |
|||
| title = The dimensions of DNA in solution |
|||
| journal = J Mol Biol |
|||
| volume = 152 |
|||
| issue = 1 |
|||
| pages = 153–161 |
|||
| year = 1981 |
|||
| pmid = 7338906 |
|||
| doi = 10.1016/0022-2836(81)90099-1 |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| last1 = Mandelkern |
|||
| first1 = M |
|||
| last2 = Elias |
|||
| first2 = J |
|||
| last3 = Eden |
|||
| first3 = D |
|||
| last4 = Crothers |
|||
| first4 = D |
|||
| display-authors = 2 |
|||
| title = The dimensions of DNA in solution |
|||
| journal = J Mol Biol |
|||
| volume = 152 |
|||
| issue = 1 |
|||
| pages = 153–161 |
|||
| year = 1981 |
|||
| pmid = 7338906 |
|||
| doi = 10.1016/0022-2836(81)90099-1 |
|||
}} |
|||
|- |
|||
| Newspaper article |
|||
| <pre>{{Citation |
|||
| last = Smith |
|||
| first = Joseph III |
|||
| author-link = Joseph Smith III |
|||
| title = Last Testimony of Sister Emma |
|||
| newspaper = The Saints' Herald |
|||
| location = Plano, IL |
|||
| volume = 26 |
|||
| issue = 19 |
|||
| date = October 1, 1879 |
|||
| page = 289 |
|||
| url = http://www.sidneyrigdon.com/dbroadhu/ |
|||
IL/sain1872.htm#100179 |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| last = Smith |
|||
| first = Joseph III |
|||
| author-link = Joseph Smith III |
|||
| title = Last Testimony of Sister Emma |
|||
| newspaper = The Saints' Herald |
|||
| location = Plano, IL |
|||
| volume = 26 |
|||
| issue = 19 |
|||
| date = October 1, 1879 |
|||
| page = 289 |
|||
| url = http://www.sidneyrigdon.com/dbroadhu/IL/sain1872.htm#100179 |
|||
}} |
|||
|} |
|||
===Conference papers and public lectures=== |
|||
{| class="wikitable" |
|||
|- |
|||
| Conference paper |
|||
| <pre>{{Citation |
|||
| last = Sullivan |
|||
| first = D.B. |
|||
| contribution = Time and frequency measurement |
|||
at NIST: The first 100 years |
|||
| year = 2001 |
|||
| title = 2001 IEEE Int'l Frequency Control Symp. |
|||
| publisher = National Institute of Standards and Technology |
|||
| contribution-url = http://tf.nist.gov/timefreq/general/pdf/1485.pdf |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| last = Sullivan |
|||
| first = D.B. |
|||
| contribution = Time and frequency measurement at NIST: The first 100 years |
|||
| year = 2001 |
|||
| title = 2001 IEEE Int'l Frequency Control Symp. |
|||
| publisher = National Institute of Standards and Technology |
|||
| contribution-url = http://tf.nist.gov/timefreq/general/pdf/1485.pdf |
|||
}} |
|||
|- |
|||
| Lecture |
|||
| <pre>{{Citation |
|||
| last = Habicht |
|||
| first = Christian |
|||
| contribution = Hellenistic Athens and her Philosophers |
|||
| year = 1988 |
|||
| title = David Magie Lecture, Princeton University Program in the History, Archaeology, and Religions of the Ancient World |
|||
| publisher = Princeton University |
|||
| page=14 |
|||
}} |
|||
</pre> |
|||
|{{Citation |
|||
| last = Habicht |
|||
| first = Christian |
|||
| contribution = Hellenistic Athens and her Philosophers |
|||
| year = 1988 |
|||
| title = David Magie Lecture, Princeton University Program in the History, Archaeology, and Religions of the Ancient World |
|||
| publisher = Princeton University |
|||
| page=14 |
|||
}} |
|||
|} |
|||
===Parts of books, including encyclopedia articles=== |
|||
{| class="wikitable" |
|||
|- |
|||
|Manuscript published in an edited compilation |
|||
|<pre>{{Citation |
|||
| last = Bidamon |
|||
| first = Emma Smith |
|||
| author-link = Emma Hale Smith |
|||
| chapter = Letter to Emma S. Pilgrim |
|||
| date = March 27, 1876 |
|||
| editor-last = Vogel |
|||
| editor-first = Dan |
|||
| title = Early Mormon Documents |
|||
| volume = 1 |
|||
| publisher = Signature Books |
|||
| publication-date = 1996 |
|||
| isbn = 1-56085-072-8 |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| last = Bidamon |
|||
| first = Emma Smith |
|||
| author-link = Emma Hale Smith |
|||
| chapter = Letter to Emma S. Pilgrim |
|||
| date = March 27, 1876 |
|||
| editor-last = Vogel |
|||
| editor-first = Dan |
|||
| title = Early Mormon Documents |
|||
| volume = 1 |
|||
| publisher = Signature Books |
|||
| publication-date = 1996 |
|||
| isbn = 1-56085-072-8 |
|||
}} |
|||
|- |
|||
| Work with an editor but no author |
|||
| <pre>{{Citation |
|||
| editor-last = Vogel |
|||
| editor-first = Dan |
|||
| title = Early Mormon Documents |
|||
| volume = 1 |
|||
| publisher = Signature Books |
|||
| date = 1996 |
|||
| isbn = 1-56085-072-8 |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| editor-last = Vogel |
|||
| editor-first = Dan |
|||
| title = Early Mormon Documents |
|||
| volume = 1 |
|||
| publisher = Signature Books |
|||
| date = 1996 |
|||
| isbn = 1-56085-072-8 |
|||
}} |
|||
|- |
|||
| Encyclopedia article by a named author |
|||
| <pre>{{Citation |
|||
| last = Kramer |
|||
| first = Martin |
|||
| author-link = Martin Kramer |
|||
| year=1999 |
|||
| title = Bernard Lewis |
|||
| editor-last = Boyd |
|||
| editor-first = Kelley |
|||
| encyclopedia = Encyclopedia of Historians and Historical Writing |
|||
| volume = 1 |
|||
| pages = 719–720 |
|||
| location = London |
|||
| publisher = Fitzroy Dearborn |
|||
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| last = Kramer |
|||
| first = Martin |
|||
| author-link = Martin Kramer |
|||
| year = 1999 |
|||
| title = Bernard Lewis |
|||
| editor-last = Boyd |
|||
| editor-first = Kelley |
|||
| encyclopedia = Encyclopedia of Historians and Historical Writing |
|||
| volume = 1 |
|||
| pages = 719–720 |
|||
| location = London |
|||
| publisher = Fitzroy Dearborn |
|||
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm |
|||
}} |
|||
|- |
|||
| Encyclopedia article with no named author |
|||
| <pre>{{Citation |
|||
| title = Bernard Lewis |
|||
| editor-last = Boyd |
|||
| editor-first = Kelley |
|||
| year = 1999 |
|||
| encyclopedia = Encyclopedia of Historians |
|||
and Historical Writing |
|||
| volume = 1 |
|||
| pages = 719–720 |
|||
| publisher = Fitzroy Dearborn |
|||
| location = London |
|||
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| title = Bernard Lewis |
|||
| editor-last = Boyd |
|||
| editor-first = Kelley |
|||
| year = 1999 |
|||
| encyclopedia = Encyclopedia of Historians and Historical Writing |
|||
| volume = 1 |
|||
| pages = 719–720 |
|||
| location = London |
|||
| publisher = Fitzroy Dearborn |
|||
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm |
|||
}} |
|||
|} |
|||
===Republications, or edited quotations in a periodical article=== |
|||
{| class="wikitable" |
|||
|- |
|||
| Manuscript edited and published in a journal |
|||
| <pre>{{Citation |
|||
| last = Knight |
|||
| first = Joseph, Sr. |
|||
| year = 1833 |
|||
| editor-last = Jessee |
|||
| editor-first = Dean |
|||
| title = Joseph Knight's Recollection |
|||
of Early Mormon History |
|||
| journal = BYU Studies |
|||
| volume = 17 |
|||
| issue = 1 |
|||
| publication-date = 1976 |
|||
| page = 35 |
|||
| url = https://byustudies.byu.edu/shop/PDFSRC/17.1Jessee.pdf |
|||
}}</pre> |
|||
| {{Citation |
|||
| last = Knight |
|||
| first = Joseph, Sr. |
|||
| year = 1833 |
|||
| editor-last = Jessee |
|||
| editor-first = Dean |
|||
| title = Joseph Knight's Recollection of Early Mormon History |
|||
| journal = BYU Studies |
|||
| volume = 17 |
|||
| issue = 1 |
|||
| publication-date = 1976 |
|||
| page = 35 |
|||
| url = https://byustudies.byu.edu/shop/PDFSRC/17.1Jessee.pdf |
|||
}} |
|||
|- |
|||
| Manuscript written at one date and place, then published in a periodical at a different date and place with commentary by the editor. |
|||
| <pre>{{Citation |
|||
| last = Klingensmith |
|||
| first = Philip |
|||
| type = Affidavit |
|||
| date = September 5, 1872 |
|||
| place = Lincoln County, Nevada |
|||
| title = Mountain Meadows Massacre |
|||
| editor-last = Toohy |
|||
| editor-first = Dennis J. |
|||
| journal = Corinne Daily Reporter |
|||
| publication-date = September 24, 1872 |
|||
| publication-place = Corinne, Utah |
|||
| volume = 5 |
|||
| issue = 252 |
|||
| page = 1 |
|||
| url = http://udn.lib.utah.edu/u?/corinne,5359 |
|||
}} |
|||
</pre> |
|||
| {{Citation |
|||
| last = Klingensmith |
|||
| first = Philip |
|||
| type = Affidavit |
|||
| date = September 5, 1872 |
|||
| place = Lincoln County, Nevada |
|||
| title = Mountain Meadows Massacre |
|||
| editor-last = Toohy |
|||
| editor-first = Dennis J. |
|||
| journal = Corinne Daily Reporter |
|||
| publication-date = September 24, 1872 |
|||
| publication-place = Corinne, Utah |
|||
| volume = 5 |
|||
| issue = 252 |
|||
| page = 1 |
|||
| url = http://udn.lib.utah.edu/u?/corinne,5359 |
|||
}} |
|||
|} |
|||
===Press release=== |
|||
{| class="wikitable" |
|||
|- |
|||
| Press release with quotation |
|||
| <pre>{{Citation |
|||
| url = https://www.apple.com/pr/library/2010/04/05ipad.html |
|||
| title = Apple Sells Over 300,000 iPads First Day |
|||
| publisher = Apple Inc |
|||
| access-date = April 10, 2010 |
|||
| quote = in the US as of midnight Saturday, April 3 |
|||
| ref = none}} |
|||
</pre> |
|||
| {{Citation |
|||
| url = https://www.apple.com/pr/library/2010/04/05ipad.html |
|||
| title = Apple Sells Over 300,000 iPads First Day |
|||
| publisher = Apple Inc |
|||
| access-date = April 10, 2010 |
|||
| quote = in the US as of midnight Saturday, April 3 |
|||
| ref = none}} |
|||
|} |
|||
==Anchored citations== |
|||
This template can generate a citation that can be combined with [[WP:CITESHORT|shortened footnotes]] or [[Wikipedia:Parenthetical referencing|parenthetical referencing]]. It does this by creating an [[HTML element#Anchor|HTML anchor]] containing an ID. The special parameter {{para|ref|harv}} generates an ID suitable for [[Harvard referencing]] templates such as {{tl|harv}} as specified in the next section; this is the default for the {{tl|citation}} template. |
|||
To disable anchor generation, specify {{para|ref|none}}. You can also specify the ID directly, using the {{para|ref|<var>ID</var>}} parameter. For example, suppose an article's ''References'' section contains the markup: |
|||
* <code><nowiki>{{Citation |author=Sigmund Freud |title=Civilization and Its Discontents |date=1930 |ref=CivDis}}</nowiki></code> |
|||
which generates the citation: |
|||
* {{Citation |author=Sigmund Freud |title=Civilization and Its Discontents |date=1930 |ref=CivDis}} |
|||
Then, the markup "<code><nowiki>([[#CivDis|Freud 1930]])</nowiki></code>" generates a parenthetical reference "([[#CivDis|Freud 1930]])" containing a wikilink to the citation (try clicking on the wikilink). |
|||
===Anchors for Harvard referencing templates=== |
|||
IDs compatible with Harvard referencing templates such as {{tl|harv}} are computed from the last names of the authors (or editors, if no authors are given) and the year of the cited source. For example, the markup "<code><nowiki>{{harv|Wright|Evans|1851|p=ix}}</nowiki></code>" generates the Harvard reference "{{harv|Wright|Evans|1851|p=ix}}", which wikilinks to the citation whose markup and appearance are shown below: |
|||
* <code><nowiki>{{Citation |last1=Wright |first1=Thomas |last2=Evans |first2=R. H. |title=Historical and Descriptive Account of the Caricatures of James Gillray |location=London |publisher=Henry G. Bohn |date=1851 |oclc=59510372}}</nowiki></code> |
|||
* {{Citation |last1=Wright |first1=Thomas |last2=Evans |first2=R. H. |title=Historical and Descriptive Account of the Caricatures of James Gillray |location=London |publisher=Henry G. Bohn |date=1851 |oclc=59510372}} |
|||
In this example the {{tl|citation}} template defines, and the {{tl|harv}} template uses, the HTML ID "<code>CITEREFWrightEvans1851</code>", composed by concatenating the string "<code>CITEREF</code>" with the last names of the authors and the year. The {{tl|harvid}} template can be used to generate such IDs, for example, <code><nowiki>{{harvid|Wright|Evans|1851}}</nowiki></code> generates "<code>{{harvid|Wright|Evans|1851}}</code>". |
|||
Related methods which leave only a number in the text are to use the {{tl|harvnb}} template enclosed in the <nowiki><ref></ref></nowiki> html code, or to use the {{tl|sfn}} template alone. The example above would be <code><nowiki><ref>{{harvnb|Wright|Evans|1851|p=ix}}</ref></nowiki></code> or <code><nowiki>{{sfn|Wright|Evans|1851|p=ix}}</nowiki></code> both of which generate a footnote, such as |
|||
:17. {{harvnb|Wright|Evans|1851|p=ix}} |
|||
The names of only the first four authors are used; other author names are not concatenated to the ID. If no author names are given, editor names are used instead. |
|||
Last names are used, as specified by the parameters {{para|last1}} (or {{para|last}}), {{para|last2}}, {{para|last3}}, and {{para|last4}}, and similarly for {{para|editor1-last}} etc. and for {{para|inventor1-last}} etc. If a full name is given but no last name is specified, this template falls back on the full name, but this usage is not recommended. For example, in "<code><nowiki>{{Citation |author=Sigmund Freud |title=The Ego and the Id |date=1923}}</nowiki></code>" no last name is given, so this citation cannot be combined with the Harvard reference "<code><nowiki>{{harv|Freud|1923}}</nowiki></code>". To make these {{tl|citation}} and {{tl|harv}} invocations compatible, either replace "{{para|author|Sigmund Freud}}" with "{{para|first|Sigmund}} {{para|last|Freud}}", or add "{{para|ref|<nowiki>{{harvid|Freud|1923}}</nowiki>}}" to the {{tl|citation}} invocation, or add the same ref parameter (say, "{{para|ref|EgoId}}") to both the {{tl|citation}} and the {{tl|harv}} invocations. |
|||
<!-- This paragraph appears to be outdated and probably needs to be updated to reflect current CS1/CS2 functionality: -->Similarly, the year is used, as specified by {{para|year}}. If no year is given, this template attempts to derive the year from {{para|date}} (or, if no date is given, from {{para|publication-date}}) by applying the [[mw:Help:Extension:ParserFunctions##time|MediaWiki § Time function]]. This heuristic works with most common date formats (American, International and [[ISO 8601#Calendar dates|ISO 8601 standard format]] YYYY-MM-DD as listed in [[WP:MOS]]), but may not work as expected with other formats, so when in doubt it may be safer to use {{para|year}}. |
|||
===IDs must be unique=== |
|||
Names, years, and hand-specified IDs must be chosen so that the IDs are unique within a page; otherwise the HTML will not conform to the W3C standards, and any references to the citations will not work reliably. For example, suppose a page contains the following two citations with {{tl|harv}}-compatible IDs: |
|||
* {{Citation |last1=Montes |first1=G. |last2=Halterman |first2=J. S. |date=2008a |journal=Pediatrics |volume=121 |issue=4 |pages=e821–e826 |title=Association of Childhood Autism Spectrum Disorders and Loss of Family Income |doi=10.1542/peds.2007-1594 |pmid=18381511 |url=http://pediatrics.aappublications.org/cgi/content/full/121/4/e821}} |
|||
* {{Citation |last1=Montes |first1=G. |last2=Halterman |first2=J. S. |date=2008b |journal=Pediatrics |volume=122 |issue=1 |pages=e202–e208 |title=Child Care Problems and Employment Among Families with Preschool-aged Children with Autism in the United States |doi=10.1542/peds.2007-3037 |pmid=18595965 |url=http://pediatrics.aappublications.org/cgi/content/full/122/1/e202}} |
|||
If these citations were altered to say "2008" rather than "2008a" and "2008b", the resulting page would not work, because the two different citations would both attempt to use the ID "<code>CITEREFMontesHalterman2008</code>". To avoid this problem, distinguish the citations by appending suffixes to the years, e.g. "{{para|date|2008a}}" and "{{para|date|2008b}}", as was done above. Any Harvard references to these citations should use years with the same suffixes. |
|||
It is good practice to verify that a page does not contain duplicate IDs by using the [[W3C Markup Validation Service]]; see ''[[#External links|External links]]''. |
|||
==Dates== |
|||
{{Reflist|group="n"|refs=<ref name="dates" group="n">The format of dates in the references of an article should use consistent and unambiguous styles. Example formats used in Wikipedia citations include: |
|||
* ''2009'' |
|||
* ''2009-09-14'' ([[ISO 8601#Calendar dates|ISO 8601 standard format]]: YYYY-MM-DD) |
|||
* ''14 September 2009'' |
|||
* ''September 14, 2009'' (with comma) |
|||
* ''September 2009'' |
|||
Dates should not be linked (say, to a Wikipedia article of the same name) in references. |
|||
Please see [[Wikipedia:Manual of Style (dates and numbers)#Dates|Wikipedia:Manual of Style (dates and numbers) § Dates]] for more guidance about formatting dates. |
|||
</ref>}} |
|||
==Tools== |
|||
See [[Wikipedia:Citing sources#Citation templates and tools|Wikipedia:Citing sources § Citation templates and tools]] for a list of tools that can help create a reference in the "citation" format. |
|||
==TemplateData== |
|||
{{notice|This template data section needs to be edited. It includes deprecated parameters and does not include parameters that were added in the Lua updates.}} |
|||
{{TemplateData header}} |
|||
<templatedata> |
|||
{ |
|||
"description": "The Citation template generates a citation for a book, periodical, contribution in a collective work, or a web page. It determines the citation type by examining which parameters are used.", |
|||
"params": { |
|||
"last": { |
|||
"label": "Last name", |
|||
"description": "The surname of the author; don't wikilink, use 'author-link' instead; can suffix with a numeral to add additional authors", |
|||
"aliases": [ |
|||
"author", |
|||
"author1", |
|||
"last1" |
|||
], |
|||
"type": "line", |
|||
"suggested": true |
|||
}, |
|||
"first": { |
|||
"label": "First name", |
|||
"description": "Given or first name, middle names, or initials of the author; don't wikilink, use 'author-link' instead; can suffix with a numeral to add additional authors", |
|||
"aliases": [ |
|||
"first1" |
|||
], |
|||
"type": "line", |
|||
"suggested": true |
|||
}, |
|||
"title": { |
|||
"label": "Title of source", |
|||
"type": "string", |
|||
"description": "Title of source. Works display in italics and articles surrounded in quotation marks.", |
|||
"required": true |
|||
}, |
|||
"date": { |
|||
"label": "Date of source", |
|||
"type": "string", |
|||
"description": "Full date of source being referenced in the same format as other publication dates in the citations.[1] Do not wikilink. Displays after the authors and enclosed in parentheses. If there is no author, then displays after publisher." |
|||
}, |
|||
"url": { |
|||
"label": "URL of source", |
|||
"type": "string", |
|||
"description": "URL of an online location where the text of the publication can be found." |
|||
}, |
|||
"publication-date": { |
|||
"label": "Publication date", |
|||
"type": "string", |
|||
"required": false, |
|||
"description": "Date of publication when different from the date the work was written. Displays only if year or date are defined and only if different, else publication-date is used and displayed as date. Use the same format as other dates in the article; do not wikilink. Follows publisher; if work is not defined, then publication-date is preceded by \"published\" and enclosed in parenthesis." |
|||
}, |
|||
"df": { |
|||
"label": "Date format", |
|||
"description": "Sets rendered dates to the specified format", |
|||
"type": "string" |
|||
}, |
|||
"year": { |
|||
"label": "Year of publication", |
|||
"description": "Year of the source being referenced; recommended only when date parameter format is YYYY-MM-DD and a CITEREF disambiguator is needed", |
|||
"type": "number" |
|||
}, |
|||
"postscript": { |
|||
"label": "Postscript", |
|||
"type": "string", |
|||
"required": false, |
|||
"description": "Controls the closing punctuation for a citation; defaults to a period (.); for no terminating punctuation, specify |postscript=none – leaving |postscript= empty is the same as omitting it, but is ambiguous. Ignored if quote is defined." |
|||
}, |
|||
"author-mask": { |
|||
"label": "Author mask", |
|||
"type": "string", |
|||
"required": false, |
|||
"aliases": [ |
|||
"authormask" |
|||
], |
|||
"description": "Replaces the name of the first author with em dashes or text. Set author-mask to a numeric value n to set the dash n em spaces wide; set author-mask to a text value to display the text without a trailing author separator; for example, \"with\". You must still include the values for all authors for metadata purposes. Primarily intended for use with bibliographies or bibliography styles where multiple works by a single author are listed sequentially such as shortened footnotes. Do not use in a list generated by {{reflist}}, <references /> or similar as there is no control of the order in which references are displayed. You can also use editor-mask and translator-mask in the same way." |
|||
}, |
|||
"last2": { |
|||
"label": "Last name 2", |
|||
"description": "The surname of the second author; don't wikilink, use 'author-link2' instead.", |
|||
"aliases": [ |
|||
"author2", |
|||
"surname2" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"first2": { |
|||
"label": "First name 2", |
|||
"description": "Given or first name, middle names, or initials of the second author; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"given2" |
|||
] |
|||
}, |
|||
"last3": { |
|||
"label": "Last name 3", |
|||
"description": "The surname of the third author; don't wikilink, use 'author-link3' instead.", |
|||
"aliases": [ |
|||
"author3", |
|||
"surname3" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"first3": { |
|||
"label": "First name 3", |
|||
"description": "Given or first name, middle names, or initials of the third author; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"given3" |
|||
] |
|||
}, |
|||
"last4": { |
|||
"label": "Last name 4", |
|||
"description": "The surname of the forth author; don't wikilink, use 'author-link4' instead.", |
|||
"aliases": [ |
|||
"author4", |
|||
"surname4" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"first4": { |
|||
"label": "First name 4", |
|||
"description": "Given or first name, middle names, or initials of the forth author; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"given4" |
|||
] |
|||
}, |
|||
"last5": { |
|||
"label": "Last name 5", |
|||
"description": "The surname of the fifth author; don't wikilink, use 'author-link5' instead.", |
|||
"aliases": [ |
|||
"author5", |
|||
"surname5" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"first5": { |
|||
"label": "First name 5", |
|||
"description": "Given or first name, middle names, or initials of the fifth author; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"given5" |
|||
] |
|||
}, |
|||
"last6": { |
|||
"label": "Last name 6", |
|||
"description": "The surname of the sixth author; don't wikilink, use 'author-link6' instead.", |
|||
"aliases": [ |
|||
"author6", |
|||
"surname6" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"first6": { |
|||
"label": "First name 6", |
|||
"description": "Given or first name, middle names, or initials of the sixth author; don't wikilink.", |
|||
"type": "line" |
|||
}, |
|||
"last7": { |
|||
"label": "Last name 7", |
|||
"description": "The surname of the seventh author; don't wikilink, use 'author-link7' instead.", |
|||
"aliases": [ |
|||
"author7", |
|||
"surname7" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"first7": { |
|||
"label": "First name 7", |
|||
"description": "Given or first name, middle names, or initials of the seventh author; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"given7" |
|||
] |
|||
}, |
|||
"last8": { |
|||
"label": "Last name 8", |
|||
"description": "The surname of the eighth author; don't wikilink, use 'author-link8' instead.", |
|||
"aliases": [ |
|||
"author8", |
|||
"surname8" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"first8": { |
|||
"label": "First name 8", |
|||
"description": "Given or first name, middle names, or initials of the eighth author; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"given8" |
|||
] |
|||
}, |
|||
"last9": { |
|||
"label": "Last name 9", |
|||
"description": "The surname of the ninth author; don't wikilink, use 'author-link9' instead. If nine authors are defined, then only eight will show and 'et al.' will show in place of the last author.", |
|||
"aliases": [ |
|||
"author9", |
|||
"surname9" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"first9": { |
|||
"label": "First name 9", |
|||
"description": "Given or first name, middle names, or initials of the ninth author; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"given9" |
|||
] |
|||
}, |
|||
"author-link": { |
|||
"label": "Author link", |
|||
"description": "Title of existing Wikipedia article about the author; can suffix with a numeral to add additional authors", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"authorlink", |
|||
"author1-link", |
|||
"authorlink1" |
|||
] |
|||
}, |
|||
"author-link2": { |
|||
"label": "Author link 2", |
|||
"description": "Title of existing Wikipedia article about the second author.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"author2-link", |
|||
"authorlink2" |
|||
] |
|||
}, |
|||
"author-link3": { |
|||
"label": "Author link 3", |
|||
"description": "Title of existing Wikipedia article about the third author.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"author3-link", |
|||
"authorlink3" |
|||
] |
|||
}, |
|||
"author-link4": { |
|||
"label": "Author link 4", |
|||
"description": "Title of existing Wikipedia article about the forth author.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"author4-link", |
|||
"authorlink4" |
|||
] |
|||
}, |
|||
"author-link5": { |
|||
"label": "Author link 5", |
|||
"description": "Title of existing Wikipedia article about the sixth author.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"author5-link", |
|||
"authorlink5" |
|||
] |
|||
}, |
|||
"author-link6": { |
|||
"label": "Author link 6", |
|||
"description": "Title of existing Wikipedia article about the sixth author.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"author6-link", |
|||
"authorlink6" |
|||
] |
|||
}, |
|||
"author-link7": { |
|||
"label": "Author link 7", |
|||
"description": "Title of existing Wikipedia article about the seventh author.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"author7-link", |
|||
"authorlink7" |
|||
] |
|||
}, |
|||
"author-link8": { |
|||
"label": "Author link 8", |
|||
"description": "Title of existing Wikipedia article about the eighth author.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"author8-link", |
|||
"authorlink8" |
|||
] |
|||
}, |
|||
"author-link9": { |
|||
"label": "Author link 9", |
|||
"description": "Title of existing Wikipedia article about the ninth author.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"author9-link", |
|||
"authorlink9" |
|||
] |
|||
}, |
|||
"orig-year": { |
|||
"label": "Original year", |
|||
"description": "Original year of publication; provide specifics", |
|||
"type": "number", |
|||
"aliases": [ |
|||
"origyear" |
|||
] |
|||
}, |
|||
"trans-title": { |
|||
"label": "Translated title", |
|||
"description": "An English language title, if the source cited is in a foreign language; 'language' is recommended", |
|||
"type": "content" |
|||
}, |
|||
"trans-chapter": { |
|||
"label": "Translated chapter title", |
|||
"description": "An English language chapter title, if the source cited is in a foreign language; 'language' is recommended", |
|||
"type": "content" |
|||
}, |
|||
"type": { |
|||
"label": "Type", |
|||
"description": "Additional information about the media type of the source; format in sentence case", |
|||
"type": "content" |
|||
}, |
|||
"archive-url": { |
|||
"label": "Archive URL", |
|||
"description": "The URL of an archived copy of a web page, if or in case the URL becomes unavailable; requires 'archive-date'", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"archiveurl" |
|||
] |
|||
}, |
|||
"series": { |
|||
"label": "Series", |
|||
"description": "Series identifier when the source is part of a series, such as a book series or a journal; alias of 'version'", |
|||
"type": "content", |
|||
"aliases": [ |
|||
"version" |
|||
] |
|||
}, |
|||
"work": { |
|||
"label": "Work", |
|||
"description": "Name of the work in which the cited title is found", |
|||
"type": "string", |
|||
"aliases": [ |
|||
"journal", |
|||
"website", |
|||
"newspaper", |
|||
"magazine", |
|||
"encyclopedia", |
|||
"encyclopaedia", |
|||
"dictionary", |
|||
"mailinglist", |
|||
"periodical" |
|||
] |
|||
}, |
|||
"volume": { |
|||
"label": "Volume", |
|||
"description": "For one publication published in several volumes", |
|||
"type": "line", |
|||
"suggested": true |
|||
}, |
|||
"issue": { |
|||
"label": "Issue", |
|||
"description": "Issue number", |
|||
"type": "string", |
|||
"aliases": [ |
|||
"number" |
|||
] |
|||
}, |
|||
"page": { |
|||
"label": "Page", |
|||
"description": "Page in the source that supports the content; displays after 'p.'", |
|||
"type": "line" |
|||
}, |
|||
"pages": { |
|||
"label": "Pages", |
|||
"description": "Pages in the source that support the content (not an indication of the number of pages in the source; displays after 'pp.'", |
|||
"type": "line", |
|||
"suggested": true |
|||
}, |
|||
"at": { |
|||
"label": "At", |
|||
"description": "May be used instead of 'page' or 'pages' where a page number is inappropriate or insufficient", |
|||
"type": "line" |
|||
}, |
|||
"nopp": { |
|||
"label": "No pp", |
|||
"description": "Set to 'y' to suppress the 'p.' or 'pp.' display with 'page' or 'pages' when inappropriate (such as 'Front cover')", |
|||
"type": "line" |
|||
}, |
|||
"chapter": { |
|||
"label": "Chapter", |
|||
"description": "The chapter heading of the source", |
|||
"type": "string" |
|||
}, |
|||
"contribution": { |
|||
"label": "contribution", |
|||
"type": "string", |
|||
"required": false |
|||
}, |
|||
"chapter-url": { |
|||
"label": "chapter-url", |
|||
"type": "string", |
|||
"required": false, |
|||
"aliases": [ |
|||
"chapterurl" |
|||
] |
|||
}, |
|||
"contribution-url": { |
|||
"label": "contribution-url", |
|||
"type": "string", |
|||
"required": false |
|||
}, |
|||
"chapter-format": { |
|||
"label": "chapter-format", |
|||
"type": "string", |
|||
"required": false |
|||
}, |
|||
"others": { |
|||
"label": "Others", |
|||
"type": "string", |
|||
"required": false, |
|||
"description": "Free-text field for people involved in creating a work who cannot be added with another name parameter such as author or editor" |
|||
}, |
|||
"edition": { |
|||
"label": "Edition", |
|||
"description": "When the publication has more than one edition; for example: '2nd', 'Revised' etc.; suffixed with ' ed.'", |
|||
"type": "line" |
|||
}, |
|||
"place": { |
|||
"label": "Location of publication", |
|||
"description": "Geographical place of publication; usually not wikilinked", |
|||
"type": "string", |
|||
"aliases": [ |
|||
"location" |
|||
] |
|||
}, |
|||
"publication-place": { |
|||
"label": "Place of publication", |
|||
"description": "Publication place shows after title; if 'place' or 'location' are also given, they are displayed before the title prefixed with 'written at'", |
|||
"type": "content" |
|||
}, |
|||
"publisher": { |
|||
"label": "Publisher", |
|||
"description": "Name of the publisher; displays after title", |
|||
"type": "content" |
|||
}, |
|||
"language": { |
|||
"label": "Language", |
|||
"description": "The language in which the source is written, if not English; use the full language name; do not use icons or templates", |
|||
"type": "content" |
|||
}, |
|||
"format": { |
|||
"label": "Format", |
|||
"description": "Format of the work referred to by 'url' ('url' is required when using 'format'); examples: PDF, DOC, XLS; do not specify HTML", |
|||
"type": "content" |
|||
}, |
|||
"arxiv": { |
|||
"label": "arXiv identifier", |
|||
"description": "An identifier for arXive electronic preprints of scientific papers", |
|||
"type": "line" |
|||
}, |
|||
"asin": { |
|||
"label": "ASIN", |
|||
"description": "Amazon Standard Identification Number; 10 characters", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"ASIN" |
|||
] |
|||
}, |
|||
"asin-tld": { |
|||
"label": "ASIN TLD", |
|||
"description": "ASIN top-level domain for Amazon sites other than the US", |
|||
"type": "line" |
|||
}, |
|||
"bibcode": { |
|||
"label": "Bibcode", |
|||
"description": "Bibliographic Reference Code (REFCODE); 19 characters", |
|||
"type": "line" |
|||
}, |
|||
"biorxiv": { |
|||
"label": "biorXiv", |
|||
"description": "biorXiv identifier; 6 digits", |
|||
"type": "line" |
|||
}, |
|||
"citeseerx": { |
|||
"label": "CiteSeerX", |
|||
"description": "CiteSeerX identifier; found after the 'doi=' query parameter", |
|||
"type": "line" |
|||
}, |
|||
"doi": { |
|||
"label": "DOI", |
|||
"description": "Digital Object Identifier; begins with '10.'", |
|||
"type": "string", |
|||
"aliases": [ |
|||
"DOI" |
|||
] |
|||
}, |
|||
"doi-broken-date": { |
|||
"label": "DOI broken date", |
|||
"description": "The date that the DOI was determined to be broken", |
|||
"type": "date" |
|||
}, |
|||
"isbn": { |
|||
"label": "ISBN", |
|||
"description": "International Standard Book Number; use the 13-digit ISBN where possible", |
|||
"type": "line" |
|||
}, |
|||
"issn": { |
|||
"label": "ISSN", |
|||
"description": "International Standard Serial Number (print); 8 characters; usually split into two groups of four using a hyphen", |
|||
"type": "line" |
|||
}, |
|||
"eissn": { |
|||
"label": "eISSN", |
|||
"description": "International Standard Serial Number (online); 8 characters; usually split into two groups of four using a hyphen", |
|||
"type": "line" |
|||
}, |
|||
"jfm": { |
|||
"label": "jfm code", |
|||
"description": "Jahrbuch über die Fortschritte der Mathematik classification code", |
|||
"type": "line" |
|||
}, |
|||
"jstor": { |
|||
"label": "JSTOR", |
|||
"description": "JSTOR identifier", |
|||
"type": "line" |
|||
}, |
|||
"lccn": { |
|||
"label": "LCCN", |
|||
"description": "Library of Congress Control Number", |
|||
"type": "line" |
|||
}, |
|||
"mr": { |
|||
"label": "MR", |
|||
"description": "Mathematical Reviews identifier", |
|||
"type": "line" |
|||
}, |
|||
"oclc": { |
|||
"label": "OCLC", |
|||
"description": "Online Computer Library Center number", |
|||
"type": "number" |
|||
}, |
|||
"ol": { |
|||
"label": "OL", |
|||
"description": "Open Library identifier", |
|||
"type": "line" |
|||
}, |
|||
"osti": { |
|||
"label": "OSTI", |
|||
"description": "Office of Scientific and Technical Information identifier", |
|||
"type": "line" |
|||
}, |
|||
"pmc": { |
|||
"label": "PMC", |
|||
"description": "PubMed Center article number", |
|||
"type": "number" |
|||
}, |
|||
"pmid": { |
|||
"label": "PMID", |
|||
"description": "PubMed Unique Identifier", |
|||
"type": "line" |
|||
}, |
|||
"rfc": { |
|||
"label": "RFC", |
|||
"description": "Request for Comments number", |
|||
"type": "number" |
|||
}, |
|||
"ssrn": { |
|||
"label": "SSRN", |
|||
"description": "Social Science Research Network", |
|||
"type": "line" |
|||
}, |
|||
"zbl": { |
|||
"label": "Zbl", |
|||
"description": "Zentralblatt MATH journal identifier", |
|||
"type": "line" |
|||
}, |
|||
"id": { |
|||
"label": "id", |
|||
"description": "A unique identifier used where none of the specialized ones are applicable", |
|||
"type": "line" |
|||
}, |
|||
"quote": { |
|||
"label": "Quote", |
|||
"description": "Relevant text quoted from the source; displays last, enclosed in quotes; needs to include terminating punctuation", |
|||
"type": "content" |
|||
}, |
|||
"ref": { |
|||
"label": "Ref", |
|||
"description": "An anchor identifier; can be made the target of wikilinks to full references; special value 'harv' generates an anchor suitable for the harv and sfn templates", |
|||
"type": "line" |
|||
}, |
|||
"access-date": { |
|||
"label": "URL access date", |
|||
"description": "The full date when the original URL was accessed; do not wikilink", |
|||
"type": "date", |
|||
"aliases": [ |
|||
"accessdate" |
|||
] |
|||
}, |
|||
"lay-source": { |
|||
"label": "Lay source", |
|||
"description": "Name of the source of the laysummary; displays in italics, preceded by an en dash", |
|||
"type": "string", |
|||
"aliases": [ |
|||
"laysource" |
|||
] |
|||
}, |
|||
"lay-date": { |
|||
"label": "Lay date", |
|||
"description": "Date of the summary; displays in parentheses", |
|||
"type": "date", |
|||
"aliases": [ |
|||
"laydate" |
|||
] |
|||
}, |
|||
"archive-date": { |
|||
"label": "Archive date", |
|||
"description": "Date when the original URL was archived; do not wikilink", |
|||
"type": "date", |
|||
"aliases": [ |
|||
"archivedate" |
|||
] |
|||
}, |
|||
"editor-last": { |
|||
"label": "Editor last name", |
|||
"description": "The surname of the editor; don't wikilink, use 'editor-link'; can suffix with a numeral to add additional editors", |
|||
"aliases": [ |
|||
"editor", |
|||
"editor-surname", |
|||
"editor-last1", |
|||
"editor-surname1", |
|||
"editor1", |
|||
"editor1-last", |
|||
"editor1-surname", |
|||
"editors" |
|||
] |
|||
}, |
|||
"editor-first": { |
|||
"label": "Editor first name", |
|||
"description": "The surname of the editor; don't wikilink, use 'editor-link'; can suffix with a numeral to add additional editors", |
|||
"aliases": [ |
|||
"editor-first1", |
|||
"editor-given1", |
|||
"editor1-first", |
|||
"editor1-given" |
|||
] |
|||
}, |
|||
"editor2-last": { |
|||
"label": "Editor last name 2", |
|||
"description": "The surname of the second editor; don't wikilink, use 'editor2-link'.", |
|||
"aliases": [ |
|||
"editor2" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"editor2-first": { |
|||
"label": "Editor first name 2", |
|||
"description": "Given or first name, middle names, or initials of the second editor; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"editor2-given" |
|||
] |
|||
}, |
|||
"editor3-last": { |
|||
"label": "Editor last name 3", |
|||
"description": "The surname of the third editor; don't wikilink, use 'editor3-link'.", |
|||
"aliases": [ |
|||
"editor3" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"editor3-first": { |
|||
"label": "Editor first name 3", |
|||
"description": "Given or first name, middle names, or initials of the third editor; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"editor3-given" |
|||
] |
|||
}, |
|||
"editor4-last": { |
|||
"label": "Editor last name 4", |
|||
"description": "The surname of the fourth editor; don't wikilink, use 'editor4-link'.", |
|||
"aliases": [ |
|||
"editor4" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"editor4-first": { |
|||
"label": "Editor first name 4", |
|||
"description": "Given or first name, middle names, or initials of the fourth editor; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"editor4-given" |
|||
] |
|||
}, |
|||
"editor5-last": { |
|||
"label": "Editor last name 5", |
|||
"description": "The surname of the fifth editor; don't wikilink, use 'editor5-link'.", |
|||
"aliases": [ |
|||
"editor5" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"editor5-first": { |
|||
"label": "Editor first name 5", |
|||
"description": "Given or first name, middle names, or initials of the fifth editor; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"editor5-given" |
|||
] |
|||
}, |
|||
"editor6-last": { |
|||
"label": "Editor last name 6", |
|||
"description": "The surname of the sixth editor; don't wikilink, use 'editor6-link'.", |
|||
"aliases": [ |
|||
"editor6" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"editor6-first": { |
|||
"label": "Editor first name 6", |
|||
"description": "Given or first name, middle names, or initials of the sixth editor; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"editor6-given" |
|||
] |
|||
}, |
|||
"editor7-last": { |
|||
"label": "Editor last name 7", |
|||
"description": "The surname of the seventh editor; don't wikilink, use 'editor7-link'.", |
|||
"aliases": [ |
|||
"editor7" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"editor7-first": { |
|||
"label": "Editor first name 7", |
|||
"description": "Given or first name, middle names, or initials of the seventh editor; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"editor7-given" |
|||
] |
|||
}, |
|||
"editor8-last": { |
|||
"label": "Editor last name 8", |
|||
"description": "The surname of the eighth editor; don't wikilink, use 'editor8-link'.", |
|||
"aliases": [ |
|||
"editor8" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"editor8-first": { |
|||
"label": "Editor first name 8", |
|||
"description": "Given or first name, middle names, or initials of the eighth editor; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"editor8-given" |
|||
] |
|||
}, |
|||
"editor9-last": { |
|||
"label": "Editor last name 9", |
|||
"description": "The surname of the ninth editor; don't wikilink, use 'editor9-link'.", |
|||
"aliases": [ |
|||
"editor9" |
|||
], |
|||
"type": "line" |
|||
}, |
|||
"editor9-first": { |
|||
"label": "Editor first name 9", |
|||
"description": "Given or first name, middle names, or initials of the ninth editor; don't wikilink.", |
|||
"type": "line", |
|||
"aliases": [ |
|||
"editor9-given" |
|||
] |
|||
}, |
|||
"editor-link": { |
|||
"label": "editor-link", |
|||
"type": "string", |
|||
"required": false |
|||
}, |
|||
"editor1-link": { |
|||
"label": "editor1-link", |
|||
"type": "string", |
|||
"required": false |
|||
}, |
|||
"editor2-link": { |
|||
"label": "editor2-link", |
|||
"type": "string", |
|||
"required": false |
|||
}, |
|||
"editor3-link": { |
|||
"label": "editor3-link", |
|||
"type": "string", |
|||
"required": false |
|||
}, |
|||
"editor4-link": { |
|||
"label": "editor4-link", |
|||
"type": "string", |
|||
"required": false |
|||
}, |
|||
"translator-last": { |
|||
"label": "Translator last name", |
|||
"description": "The surname of the translator; don't wikilink, use 'translator-link'; can suffix with a numeral to add additional translators.", |
|||
"aliases": [ |
|||
"translator", |
|||
"translator-last1", |
|||
"translator1", |
|||
"translator1-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first": { |
|||
"label": "Translator first name", |
|||
"description": "Given or first name, middle names, or initials of the translator; don't wikilink, use 'translator-link'; can suffix with a numeral to add additional translators.", |
|||
"aliases": [ |
|||
"translator1-first", |
|||
"translator-first1" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-link": { |
|||
"label": "Translator link", |
|||
"description": "Title of existing Wikipedia article about the translator; can suffix with a numeral to add additional translators.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator-link1", |
|||
"translator1-link" |
|||
] |
|||
}, |
|||
"translator-last2": { |
|||
"label": "Translator last name 2", |
|||
"description": "The surname of the second translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator2", |
|||
"translator2-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first2": { |
|||
"label": "Translator first name 2", |
|||
"description": "Given or first name, middle names, or initials of the second translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator2-first" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-last3": { |
|||
"label": "Translator last name 3", |
|||
"description": "The surname of the third translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator3", |
|||
"translator3-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first3": { |
|||
"label": "Translator first name 3", |
|||
"description": "Given or first name, middle names, or initials of the third translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator3-first" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-last4": { |
|||
"label": "Translator last name 4", |
|||
"description": "The surname of the fourth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator4", |
|||
"translator4-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first4": { |
|||
"label": "Translator first name 4", |
|||
"description": "Given or first name, middle names, or initials of the fourth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator4-first" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-last5": { |
|||
"label": "Translator last name 5", |
|||
"description": "The surname of the fifth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator5", |
|||
"translator5-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first5": { |
|||
"label": "Translator first name 5", |
|||
"description": "Given or first name, middle names, or initials of the fifth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator5-first" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-last6": { |
|||
"label": "Translator last name 6", |
|||
"description": "The surname of the sixth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator6", |
|||
"translator6-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first6": { |
|||
"label": "Translator first name 6", |
|||
"description": "Given or first name, middle names, or initials of the sixth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator6-first" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-last7": { |
|||
"label": "Translator last name 7", |
|||
"description": "The surname of the seventh translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator7", |
|||
"translator7-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first7": { |
|||
"label": "Translator first name 7", |
|||
"description": "Given or first name, middle names, or initials of the seventh translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator7-first" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-last8": { |
|||
"label": "Translator last name 8", |
|||
"description": "The surname of the eighth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator8", |
|||
"translator8-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first8": { |
|||
"label": "Translator first name 8", |
|||
"description": "Given or first name, middle names, or initials of the eighth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator8-first" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-last9": { |
|||
"label": "Translator last name 9", |
|||
"description": "The surname of the ninth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator9", |
|||
"translator9-last" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-first9": { |
|||
"label": "Translator first name 9", |
|||
"description": "Given or first name, middle names, or initials of the ninth translator; don't wikilink, use 'translator-link'.", |
|||
"aliases": [ |
|||
"translator9-first" |
|||
], |
|||
"type": "string" |
|||
}, |
|||
"translator-link2": { |
|||
"label": "Translator link 2", |
|||
"description": "Title of existing Wikipedia article about the second translator.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator2-link" |
|||
] |
|||
}, |
|||
"translator-link3": { |
|||
"label": "Translator link 3", |
|||
"description": "Title of existing Wikipedia article about the third translator.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator3-link" |
|||
] |
|||
}, |
|||
"translator-link4": { |
|||
"label": "Translator link 4", |
|||
"description": "Title of existing Wikipedia article about the fourth translator.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator4-link" |
|||
] |
|||
}, |
|||
"translator-link5": { |
|||
"label": "Translator link 5", |
|||
"description": "Title of existing Wikipedia article about the fifth translator.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator5-link" |
|||
] |
|||
}, |
|||
"translator-link6": { |
|||
"label": "Translator link 6", |
|||
"description": "Title of existing Wikipedia article about the sixth translator.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator6-link" |
|||
] |
|||
}, |
|||
"translator-link7": { |
|||
"label": "Translator link 7", |
|||
"description": "Title of existing Wikipedia article about the seventh translator.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator7-link" |
|||
] |
|||
}, |
|||
"translator-link8": { |
|||
"label": "Translator link 8", |
|||
"description": "Title of existing Wikipedia article about the eighth translator.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator8-link" |
|||
] |
|||
}, |
|||
"translator-link9": { |
|||
"label": "Translator link 9", |
|||
"description": "Title of existing Wikipedia article about the ninth translator.", |
|||
"type": "wiki-page-name", |
|||
"aliases": [ |
|||
"translator9-link" |
|||
] |
|||
}, |
|||
"lay-url": { |
|||
"aliases": [ |
|||
"layurl" |
|||
], |
|||
"label": "Lay URL", |
|||
"description": "URL link to a non-technical summary or review of the source", |
|||
"type": "line" |
|||
}, |
|||
"display-authors": { |
|||
"label": "Display authors", |
|||
"description": "number of authors to display before 'et al.' is used; must be less than the number listed", |
|||
"type": "number" |
|||
}, |
|||
"name-list-style": { |
|||
"aliases": [ |
|||
"name-list-format" |
|||
], |
|||
"label": "Name list style", |
|||
"description": "Sets the style for the list. Accepts 'amp', 'and', and 'vanc'. amp displays an ampersand after the penultimate name; and the same with 'and', and vanc displays in Vancouver format", |
|||
"type": "string" |
|||
} |
|||
}, |
|||
"maps": { |
|||
"citoid": { |
|||
"edition": "edition", |
|||
"title": "title", |
|||
"caseName": "title", |
|||
"nameOfAct": "title", |
|||
"url": "url", |
|||
"label": "publisher", |
|||
"company": "publisher", |
|||
"studio": "publisher", |
|||
"network": "publisher", |
|||
"distributor": "publisher", |
|||
"publisher": "publisher", |
|||
"publicationTitle": "work", |
|||
"dictionaryTitle": "work", |
|||
"encyclopediaTitle": "work", |
|||
"bookTitle": "work", |
|||
"date": "date", |
|||
"dateEnacted": "date", |
|||
"dateDecided": "date", |
|||
"accessDate": "access-date", |
|||
"place": "place", |
|||
"ISSN": [ |
|||
"issn" |
|||
], |
|||
"ISBN": [ |
|||
"isbn" |
|||
], |
|||
"PMCID": "pmc", |
|||
"PMID": "pmid", |
|||
"oclc": "oclc", |
|||
"pages": "pages", |
|||
"firstPage": "pages", |
|||
"codePages": "pages", |
|||
"volume": "volume", |
|||
"reporterVolume": "volume", |
|||
"codeVolume": "volume", |
|||
"series": "series", |
|||
"programTitle": "series", |
|||
"episodeNumber": "issue", |
|||
"billNumber": "issue", |
|||
"documentNumber": "issue", |
|||
"publicLawNumber": "issue", |
|||
"docketNumber": "issue", |
|||
"issue": "issue", |
|||
"type": "type", |
|||
"genre": "type", |
|||
"letterType": "type", |
|||
"mapType": "type", |
|||
"DOI": "doi", |
|||
"language": "language", |
|||
"podcaster": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"cartographer": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"interviewee": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"performer": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"programmer": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"sponsor": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"artist": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"director": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"contributor": "others", |
|||
"author": [ |
|||
[ |
|||
"first", |
|||
"last" |
|||
], |
|||
[ |
|||
"first2", |
|||
"last2" |
|||
], |
|||
[ |
|||
"first3", |
|||
"last3" |
|||
], |
|||
[ |
|||
"first4", |
|||
"last4" |
|||
], |
|||
[ |
|||
"first5", |
|||
"last5" |
|||
], |
|||
[ |
|||
"first6", |
|||
"last6" |
|||
], |
|||
[ |
|||
"first7", |
|||
"last7" |
|||
], |
|||
[ |
|||
"first8", |
|||
"last8" |
|||
], |
|||
[ |
|||
"first9", |
|||
"last9" |
|||
] |
|||
], |
|||
"translator": [ |
|||
[ |
|||
"translator-first", |
|||
"translator-last" |
|||
], |
|||
[ |
|||
"translator-first2", |
|||
"translator-last2" |
|||
], |
|||
[ |
|||
"translator-first3", |
|||
"translator-last3" |
|||
], |
|||
[ |
|||
"translator-first4", |
|||
"translator-last4" |
|||
], |
|||
[ |
|||
"translator-first5", |
|||
"translator-last5" |
|||
], |
|||
[ |
|||
"translator-first6", |
|||
"translator-last6" |
|||
], |
|||
[ |
|||
"translator-first7", |
|||
"translator-last7" |
|||
], |
|||
[ |
|||
"translator-first8", |
|||
"translator-last8" |
|||
], |
|||
[ |
|||
"translator-first9", |
|||
"translator-last9" |
|||
] |
|||
], |
|||
"editor": [ |
|||
[ |
|||
"editor-first", |
|||
"editor-last" |
|||
], |
|||
[ |
|||
"editor2-first", |
|||
"editor2-last" |
|||
], |
|||
[ |
|||
"editor3-first", |
|||
"editor3-last" |
|||
], |
|||
[ |
|||
"editor4-first", |
|||
"editor4-last" |
|||
] |
|||
] |
|||
} |
|||
}, |
|||
"paramOrder": [ |
|||
"last", |
|||
"first", |
|||
"title", |
|||
"date", |
|||
"url", |
|||
"work", |
|||
"volume", |
|||
"issue", |
|||
"page", |
|||
"pages", |
|||
"publication-date", |
|||
"df", |
|||
"year", |
|||
"postscript", |
|||
"editor-last", |
|||
"editor-first", |
|||
"author-mask", |
|||
"orig-year", |
|||
"trans-title", |
|||
"trans-chapter", |
|||
"type", |
|||
"archive-url", |
|||
"series", |
|||
"at", |
|||
"nopp", |
|||
"chapter", |
|||
"contribution", |
|||
"chapter-url", |
|||
"contribution-url", |
|||
"chapter-format", |
|||
"others", |
|||
"edition", |
|||
"place", |
|||
"publication-place", |
|||
"publisher", |
|||
"language", |
|||
"format", |
|||
"arxiv", |
|||
"asin", |
|||
"asin-tld", |
|||
"bibcode", |
|||
"biorxiv", |
|||
"citeseerx", |
|||
"doi", |
|||
"doi-broken-date", |
|||
"isbn", |
|||
"issn", |
|||
"eissn", |
|||
"jfm", |
|||
"jstor", |
|||
"lccn", |
|||
"mr", |
|||
"oclc", |
|||
"ol", |
|||
"osti", |
|||
"pmc", |
|||
"pmid", |
|||
"rfc", |
|||
"ssrn", |
|||
"zbl", |
|||
"id", |
|||
"quote", |
|||
"ref", |
|||
"access-date", |
|||
"lay-url", |
|||
"lay-source", |
|||
"lay-date", |
|||
"name-list-style", |
|||
"display-authors", |
|||
"archive-date", |
|||
"last2", |
|||
"first2", |
|||
"last3", |
|||
"first3", |
|||
"last4", |
|||
"first4", |
|||
"last5", |
|||
"first5", |
|||
"last6", |
|||
"first6", |
|||
"last7", |
|||
"first7", |
|||
"last8", |
|||
"first8", |
|||
"last9", |
|||
"first9", |
|||
"author-link", |
|||
"author-link2", |
|||
"author-link3", |
|||
"author-link4", |
|||
"author-link5", |
|||
"author-link6", |
|||
"author-link7", |
|||
"author-link8", |
|||
"author-link9", |
|||
"editor2-last", |
|||
"editor2-first", |
|||
"editor3-last", |
|||
"editor3-first", |
|||
"editor4-last", |
|||
"editor4-first", |
|||
"editor5-last", |
|||
"editor5-first", |
|||
"editor6-last", |
|||
"editor6-first", |
|||
"editor7-last", |
|||
"editor7-first", |
|||
"editor8-last", |
|||
"editor8-first", |
|||
"editor9-last", |
|||
"editor9-first", |
|||
"editor-link", |
|||
"editor1-link", |
|||
"editor2-link", |
|||
"editor3-link", |
|||
"editor4-link", |
|||
"translator-last", |
|||
"translator-first", |
|||
"translator-link", |
|||
"translator-last2", |
|||
"translator-first2", |
|||
"translator-last3", |
|||
"translator-first3", |
|||
"translator-last4", |
|||
"translator-first4", |
|||
"translator-last5", |
|||
"translator-first5", |
|||
"translator-last6", |
|||
"translator-first6", |
|||
"translator-last7", |
|||
"translator-first7", |
|||
"translator-last8", |
|||
"translator-first8", |
|||
"translator-last9", |
|||
"translator-first9", |
|||
"translator-link2", |
|||
"translator-link3", |
|||
"translator-link4", |
|||
"translator-link5", |
|||
"translator-link6", |
|||
"translator-link7", |
|||
"translator-link8", |
|||
"translator-link9" |
|||
] |
|||
} |
|||
</templatedata> |
|||
{{UF-COinS}} |
|||
== See also == |
|||
* [[Wikipedia:Citation templates]] |
|||
* [[Wikipedia:Inline citation]] |
|||
* [[Wikipedia:Parenthetical referencing]] |
|||
* For a comparison of citations using templates with citations written freehand, see [[Wikipedia:Citing sources/Example edits for different methods#Footnotes|Wikipedia:Citing sources/Example edits for different methods § Footnotes]] |
|||
== Notes == |
|||
{{Reflist}} |
|||
{{Wikipedia referencing}} |
|||
{{Wikipedia help pages}} |
|||
<includeonly>{{Sandbox other|| |
|||
<!-- Categories go below this line, please; interwikis go to Wikidata, thank you! --> |
|||
[[Category:Citation Style 2 templates]] |
|||
}}</includeonly> |
|||
Revision as of 16:37, 30 November 2020
documentation subpage categories go where indicated at the bottom this pagepleaseinterwikis go toWikidatasee alsowikipediawukidataforthenbspcitation neededtemplatetlcitation neededifeqpagenamehootpagenamecascadeprotected templateifeqpagenamerootpagenanehighrisk189000csdoclualua thecitationtemplate generates a citation for a bookperiodicalcontribution in a collective work or a web page it determines the citation type by examining which parameters are used as with other citation templatesthis template can be used either in a footnotebetweentagreftagsor in a section that lists sourcesthis template uses the same lualuacode ashelpcitationstylecitation style templates with parameters to change the displayed format tohelpcitationstylecitation style if the correct parameters are used this template produces output identical to thatthe cite templates such as tl cite book andty cite webwith one important exceptionby defaultthis citation template uses commas in places where the cite templates use periods full stops by default either type template can use periodsfull stops or commas by using an optional parameter regardlesswhich citation templates are used or even if none are used at allall citations should have the same format throughout an article in the savedrendered text noteall parameternames must belowercasesimple citation this section covers the most com monly used parameters you can copy the horizontal form or vertical form below and then add in extra parameters from the full listspacing and orderingthe parameters within the template is irrelevant and does not affect the final rendered textcodenowiki citation lastfirstyeartitlepublisherpublicationplacepageuraccessdatenowikicodeclasswikitableprecitation lastfirstyeartitlepublisher publicationplacepageurl accessdatepre lastthe authors surname or last namedont use with theauthorparameterfirstthe author's first or given name(s)yearyear authorship or publication mandatory for use with links fromtemplateharvard citationunlessparadatespecifies both month and yeartitleitlethe work mandatory for web references publisherthe name the publisheromit terms such as publisherscoincktdetcbut retain the wordsbooksor pressnot normally included where the publication is a periodical which has its own wikipedia articleeg newsweekbillboarmagazinebillboard]publicationplaceorplaceorlocationthe citypublication if more than one town city is listed on the title page give the first one or the locationthe publisher's head office omit when the publication is a periodical whose name specifies the location e gthe new york times the times india pageFor use when one page is cited adds pbefore the page number do not use with pagesurlauniform resource locator urlan online location where the item can be found if the url includes double quotes these must be encoded asaccessdatedateref groupn namedateswhen the url was accessedexampleclasswikitableprecitationlastturnerfirstorsamus titlehistorythe pioneer settlement phelps and gorham's purchaseand morrisreservepublisherwilliam alling placerochesternewyorkyear 1851ol7120924Wprecitation lastturnerfirstorsamustitlehistory the pioneer settlement phelps and gorhams purchase and morris reserve publisherwilliamalling placerochesternew york year1851ol7120924wfull citation parametersnoticethis section needs to be edited it includes deprecated parameters and does not include parameters that were added in the updatesthese can be used for all types publicationallare optional and indentation is used simply to group related items these may be mutually exclusive where indicated. some hyphenated names can also be placed without hyphensclasswikitableprecitation authorlastfirst author last first author link author link authorseparator author name separator author mask displayauthorseditoreditor last editorfirsteditoreditorlast editorfirst editorlinkeditorlink translatorlasttranslatorfirsttranslatorlink translatorlast translatorfirst translatorlinkothers publicationdatedateyearorigyeartitle chapterchapterur chapterformatcontribution contributionurtype journalperiodicalnewspapermagazine encyclopediaworkeditionseriesvolume issuepublisherpublicationplace place languagepagepagesnoppatidisbnissnoclcpmid pmcbibcodedoi doiinactive date zbl urlaccessdate format archiveurl archivedate urlstatus quote layurl laysource laydateseparator postscriref preparameterssyntaxcsdocsyntaxluacsdocsepcommaluaacsdoccoinsluaswhats newcsdocwhats newdeprecatedcsdocdeprecatedluadescriptionauthorscsdocauthorluacontributoryesothersyeseditorscsdoceditorlua titlecsdoctitleluatitleformatitalicscsdocchapterluacsdoctypelua csdoclanguagelua datecsdocdateluawork csdocjournalluapublishecsdocpublisherluaeditionseriesvolumecsdocedition|luacsdocseriesluacsdocvolumeluainsource locationscsdocpagesluaurlanchorurcsdocurlchapteranchorchapterurcsdocchapterurlluaanchor csdocrefluaidentifiersanchoridcsdocidlua anchoridcsdocidluaquotecsdocquoteluacslaysummarycsdoclaydisplay optionscsdocdisplayluanosubscription or registration requiredcsdocregistrationluaexamplesbooksclasswikitablethree authorsa volumeand an editionampersandampforced before final authors nameprecitation lastlincolnfirstalastwashingtonfirst glastadamsfirstjnameliststyle amptitleall thepresidentsnames publisherthe pentagon placehomebasenewyorkvolume xiieditionndyear 200precitationlastlincolnfirstlast washingtonfirstg lastadams firstj nameliststyleamp titleallthepresidents namespublisherthepentagonplace home basenewyork volume xiieditionndyear2007webclasswikitablewebpageprecitationurl httpnrhpfocusnpsgovtitle npsfocusworknationalregister oHistoric placespublishernationalpark serviceaccessdatenovember302010ref noneprecitationurlhttpnrhpfocusnpsgovtitle nps focusworknational registerhistoric placespublishernationalpark serviceaccessdatenovember302010ref none archived pageprecitatio url httpliftoffmsfcnasagovacademyspaceatmospherehtmltitleearth's Atmosphereaccessdateoctober 25 2007 publishernational aeronautics and space administration]year 1995authornassaarchiveurl httpwebarchiveorgweb20071013232332http liftoffmsfcnasagovacademyspaceatmospherehtmlarchivedateoctober 13 200precitationurl httpliftoffmsfcnasagovacademyspaceatmospherehtmltitleearth's atmosphereaccessdateoctober 252007publishernationalaeronautics and space administration year1995 authornassaarchiveurl httpwebarchiveorgweb20071013232332httpliftoffmsfcnasagovacademyspaceatmospherehtmlarchivedateoctober 13 2007journalsnewspapersmagazines or other periodicalsclasswikitablejournal article precitationlasthillfirstmarvin s titlejosephsmithandthe1826 trialnew evidence and new Difficultiesjournalbyustudies volume issueyear197pages18url httpbyustudiesbyuedushoppDFSRC122hillpdf prcitationlasthillfirsrmarvin stitle joseph smith and the 1826 trialnew evidence and new difficultiesjournal byu studiesvolume12issueyear1976pages 18 urlhttpbyustudiesbyuedushoppdfsrc122hillpdfJournalarticle with multiple authors and identifier precitation lastmandelkern firstmlasteliasfirstjlastedenfirst dlastcrothersfirstddisplayauthors title the dimension dna in solutionjournal h mol biolvolume 152issue pages 153161year1981pmid7338906 doi1010160022283681900991 precitationlastmandelkern firstmlaseliasfirsjlasedenfirsdlas crothersfirsddisplayauthorstitlethe dimensions dnain solutionjournaljmolbiovolume 152issuepages153161year1981pmid 7338906 doi1010160022283681900991newspaper articleprecitationlastsmithfirstjoseph authorlinkjosephsmith titlelasttestimonysister emmanewspaperthesaintsheraldlocationplanoilvolume 26issue19dateoctober11879page289url httpwwwsidneyrigdoncomdbroadhu ilsain1872htm100179precitation lastsmithfirstjoseph authorlinkjosephsmith titlelast testimony sister emma newspaperthesaintsheraldlocationplanovolume26issue19dateoctober 1879page289url httpwwwsidneyrigdoncomdbroadhuilsain1872htm100179conference papers and public lecturesclasswikitable conference paperprecitation lastsullivanfirstdb contributiontime and frequency measurementatnistthe first 100 yearsyear2001title2001 ieee int'l frequency controlsymppublishernational institutestandards and technologycontributionurl httptfnistgovtimefreqgeneralpd1485pdprecitationlastsullivanfirst dbcontributiontime and frequency measurement at nistthe first 100 yearsyear2001title 2001 ieeeintfrequency control symppublishernational institute standards and technology contributionurl httptfnistgovtimefreqgeneralpd1485pdlectureprecitationlast habichtfirstchristiancontribution hellenisticathens and her philosophersyear1988titledavid magie lectureprinceton university program in the historyarchaeology and religionsthe ancientworldpublisher princeton universitpagepre citationlasthabichtfirst christiancontributionhellenistic athens and her philosophers year1988titledavidmagielecture princeton university program in the historyarchaeologyand religionsthe ancient worldpublisherprinceton universitypagepartsbooksincluding encyclopedia articlesclasswikitable manuscript published in an edited compilationprecitationlastbidamonfirst emma smithauthorlinkemma Hale smithchapterletter to emma s pilgrimdatemarch 271876editorlast vogeleditorfirstdantitle early mormon documentsvolumepublisher signature vooks publicationdate 1996 isbn1560850728precitationlast bidamonfirst emma smithauthorlinkemma hale smithchapterletter to emma s pilgrimdate march 271876editorlast vogeleditorfirstdantitleearly mormon documentsvolumepublishersignaturebookspublicationdate1996isbn 1560850728work with an editor but no authorprecitationeditorlast vogeleditorfirstdantitleearly mormon documentsvolume publishersignature booksdate1996 isbn 1560850728precitationeditorlast vogeleditorfirstdantitle early mormon documentsvolumepublisher signature vooksdate1996isbn1560850728 encyclopedia article by a named authorprecitationlastkramerfirst martinauthorlink martinkramer year1999titlebernard lewiseditorlastboydeditorfirst kelleyencyclopediaencyclopedia historians and historical writingvolumepages 719720location london publisherfitzroydearbornurhttpwwwgeocitiescommartinkramerorgbernardlewishtmprecitationlastkramerfirst martinauthorlinkmartinkrameryear 1999titlebernard lewiseditorlast boydeditorfirstkelleyencyclopediaencyclopedia historians and historical writing volume pages 719720 location londonpublisherfitzroy dearbornurl httpwwwgeocitiescommartinkramerorgvernardlewishtm encyclopediaarticle with no named authorprecitation titlebernardlewiseditorlast boyeditorfirstKelleyyear 1999 encyclopediaencyclopediahistorians and historicalwritingvolumepages 719720 publisherfitzroy dearborn locationlondonurl httpwwwgeocitiescommartinkramerorgvernardLewishtmprecitation title vernard lewis editorlast boyd editorfirst kelleyyear 1999encyclopedia encyclopedia historians and historical Writing volume pages719720location london publisherfitzroydearborn urlhttpwwwgeocitiescommartinkramerorgvernardLewishtmrepublications or edited quotations in a periodical articleclasswikitablemanuscript edited and published in a journal precitationlastknight first josepsryear1833editorlast jesseeeditorfirst deantitle joseph knights recollectionEarly Mormon history journalbyustudies volume 17issuepublicationdate1976 page35 urlhttpbyustudiesbyuedushoppdfsrcjesseepdprecitationlastknightfirst josephsryear1833editorlast Jesseeeditorfirst dean titlejoseph knights recollection early mormonhistory journalbyustudiesvolumeissue publicationdate1976page 35urlhttpbyustudiesbyuedushopdfsrc17jesseepdf manuscript written at one date and placethen published in a periodical at a different date and place with commentary by the editorprecitation lastklingensmithfirst philip type affidavit date september 5 1872 place lincoln countynevadatitle mountain meadows massacreeditorlast toohyeditorfirstdennis jjournal corinne aaily reporterpublicationdate september 241872publicationplace corinne utah volume issue252 pageurlhttpudnlibutaheduucorinne5359prcitationlastklingensmithfirstphiliptype affidavitdateseptember1872 place lincoln county nevada title mountain meadows massacre editorlast toohyeditorfirst dennisj journalcorinne daily reporter publicationdateseptember 24 1872publicationplacecorinneutah volumeissue252pageurl http:udnlibutaheduucorinne5359press releaseclasswikitable press release with quotation precitatio urlhttpwwwapplecomprlibrary20100405padhtmtitleapple sells over 300,000 ipads first day publisherappleincaccessdateapril 2010quotein the us asmidnight saturdayaprilrefnonepre citationurl httpwwwapplecomprlibrary201004ipadhtmltitleapplesells over 300,000 ipadsdirstday publisherappleincaccessdate april 102010 quotein the us asmidnight aturdayaprilrefnoneanchored citations thistemplate can generate a citation that can be combined with wpciteshortshortened footnotesorwikipediaparenthetical referencingparenthetical referencing it does this by creating an htnl element anchorhtml anchorcontaining an id the special parameterpara refharvgenerates ansuitable for harvard referencingtemplates such astlharvas specified in the next sectionthis is the default for the tlcitationtem plateto disable anchor generationspecifypararefnone you can also specify the r directly using thepararefvarvarparameterfor examplesuppose an article's referencessection contains the markupcodenowikicitationauthorsigmund freud titlecivilization and Its Discontentsdate1930refcivdisnowikicode which generates the citationcitationauthorsigmund freudtitlecivilization and its discontentsdate1930refcivdis thenthe markupcodenowikicivdisfreud 1930nowikicode generates a parenthetical reference civdisfreud 1930containing a wikilink to the citationtry clicking on the wikilink anchors forharvard referencing templates ids compatible with Harvard referencing templates such as tlharvare compute from the last names the authorsor editorsif no authors are givenand the yearthe cited source for examplethe markupcodenowikiharvwrightevans1851pix nowikicodegenerates the harvard referenceharvwrightevans1851pixwhich wikilinks to the citation whose markup and appearance are shown belowcodenowikicitationlastwrightfirstthomaslastevansfirstrhtitlehistorical and descriptive accountthe caricaturesjames gillraylocationlondonpublisherhenry gbohndate1851 oclc59510372nowikicodecitationlastwrightfirstthomaslastevansfirstrhtitlehistorical and descriptive account the caricaturesjames gillraylocationlondonpublisher=Henry gbohndate1851oclc=59510372 In this example thetlcitation template definesand thetlharvtemplate uses the html idcodeciteref wrightEvans1851code composed by concatenating the stringcodeciterefcodewith the last namesthe authors and the yearthe tlharvidtemplate can be used to generate such idsfor examplecodenowikiharvidwrightevans1851nowikicode generatescodeharvidwrightevanscode related methods which leave only a number in the text are to use the tlharvnbtemplate enclosed in the nowikirefrefnowikihtml codeor to use thetlsfntemplate alonethe example above would be codenowikirefharvnbwrightevans1851p=ixrefnowikicodeorcodenowiksfnwrightevans1851pixnowikicode both which generate a foot such as17harvnbwrightevans1851pix the names only the first four authors are usedother author names are not concatenated to theif no author names are giveneditor names are used instead last names are usedas specified by the parametersparalastor paralastparalastparalastand paralastand similarly for paraeditorlastetcand for parainventorlastetcif a full name is given but no last name is specified, this template falls back on the full namebut this usage is not recommendedfor exampleincodenowikicitationauthorsigmund freudtitlethe ego and the iddate1923nowikicodeno last name is givenso this citation cannot be combined with the harvard reference codenowikiharvdreud1923nowikicode to make thesetlcitationand tlharvinvocations compatibleeither replaceparaauthorsigmundfreudwithparafirstsigmundparalastfreudor add pararefnowikiharvidfreud1923nowikito thetlcitationinvocationor add the same ref parametersaypararefegoIdto both the tlcitationand the tlharvinvocationsthis paragraph appears to be outdated and probably needs to be updated to reflect currentcscsfunctionalitysimilarlythe year is usedas specified byparayearif no year is given this template attempts to derive the year fromparadateorif no date is givenfrom parapublicationdate by applying themwhelpextensionparserfunctionstimenediaWikinbsptimefunctionthis heuristic works with most common date formatsamericaninternational andiso8601calendar datesiso8601 standard formatas listed in wpmosbut may not work as expected with other formatsso when in doubt it may be safer to use parayear ids must be unique Namesyearsand handspecified ids must be chosen so that the ids are unique within a pageotherwise the html will not conform to the wc standardsand any references to the citations will not work reliablyfor examplesuppose a page contains the following two citations withtlharvcompatibleids: citationlastmontesfirstglasthaltermanfirstjsdate2008ajournalpediatricsvolumeissuepagese821e826titleassociationchildhoodautismspectrumdisorders and Lossfamily incomedoi101542peds20071594pmid18381511urlhttppediatricsaappublicationsorgcgicontentfull1214e821citationlastmontefirstlasthaltermanfirstjsdate2008bjournapediatricsvolume122issue=1pagese202e208titlechild care problems and employment among families with preschoolagedchildren with Autism in the united statesdoi101542peds20073037pmid18595965urlhttppediatricsaappublicationsorgcgicontentfull1221e202ifthese citations were altered to say2008 rather than2008aand2008bthe resulting page would not workbecause the two different citations would both attempt to use the idcodecitwrefnonteshalterman2008codeto avoid this problemdistinguish the citations by appending suffixes to the yearsegparadate2008aand paradate2008b as was done aboveany harvard references to these citations should use years with the same suffixesit is good practice to verify that a page does not contain duplicateids by usingthew3cmarkup validationserviceseeexternal linksexternallinksdates reflistgroupnrefsref namedatesgroupnthe formatf dates in the referencesan article should use consistent and unambiguous stylesexample formats used in Wikipediacitations include200920090914iso8601calendar datesiso8601standard format september2009septemberwith comma septemberdates should not be linked sayto a wikipedia article the same name in referencesplease seeWikipediamanualstyledates and numbersdateswikipediananualstyle dates and numbersnbspdatesfor more guidanceformatting datesref tools seewikipediaxiting sourcescitation templates and toolswikipediaciting sourcesnbspcitation templates and toolsfor a list tools that can help create a reference in thecitationformattemplatedata noticethis template data section needs to be edite dit includes deprecated parameters and does not include parameters that were added intheluaupdatestemplatedata headertemplatedatdescriptionthe citation template generates a citation for a bookperiodicalcontribution in a collective workor a web pageit determines the citation type by examining which parameters are useparamslastlabellastnamedescriptionthe surnamethe author don't wikilinkuseauthorlinkinsteadcan suffix with a numeral to add additional authorsaliasesauthoauthorlasttypelinesuggestedtruefirstlabelfirst namedescriptionfiven or first name middle namesor initialsthe authordon't wikilinkuseauthorlinkinsteadcan suffix with a numeral to add additional authorsaliasesfirsttypelinesuggestetruetitlelabeltitlsourcetypestrindescriptiontitlesourceworks display in italics and articles surrounded in quotation marksrequiredtruedate labeldate sourcetypestringdescriptionfull datesource being referenced in the same format as other publication dates in the citations do ot wikilinkdisplays after the authors and enclosed in parenthesesif there is no authorthen displays after publisherurllabelurk sourcetypestrindescriptionurl an onlinelocation where the textthe publication can be foundpublicationdatelabelpublication datetypestringrequireddescription datepublication when different from the date the work was written. Displays only ifyear or date are defined and only if differentelse publicationdate is used and displayed as dateuse the same format as other dates in the articledo ot wikilinkfollows publisherif work is not definedthen publication-date is preceded bypublished and enclosed in parenthesisdflabeldatedormadescriptionsets rendered datesto the specified formattypestringyearlabeltear publicationdescriptionyear the source being referencedrecommended only when date parameter format is yymd and a citerefmbiguator is neededtypenumberpostscriptlabelpostscripttypestringrequireddescriptioncontrols the closing punctuation for a citationdefaults to a period for no terminating punctuation specifypostscriptnone leavingpostscriptempty is the same as omitting itbut is ambiguousignored if quote is definedauthormasklabelauthor masktypestringrequiredaliases authormaskdescriptionreplaces the name the first author with em dashes or textset authormask to a numeric value n to set the dash n em spaces wideset author mask to a text value to display the text without a trailing author separatorfor examplewithyou must still include the values for all authors for metadata purposesprimarily intended for use with bibliographies or bibliography styles where multiple works by a single author are listed sequentially such as shortened footnotesdotuse in a list generated by reflistreferencesor similar as there is no controlthe order in which references are displayedyou can also use editormask and translatormask in the same waylastlabellast namdescriptionthe surnamethe second authordontwikilinkuseauthorlink insteadaliasesauthorsurnametypelinefirslabelfirst namedescriptiongiven or first name middle namesor initialsthe second authordon't wikilinktypelinealiasesgivelaslabellast namedescriptionthe surnamethe third authordon't wikilinkuseauthorlinkinsteaaliasesauthorsurnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe third authordon't wikilinktypelinealiasesgivenlas labellastnamedescriptionthe surnamethe forth authordon't wikilinkuseauthorlinkinsteadaliases authorsurnametypelinefirstlabelfirst name descriptiongiven orfirst name middle names or initialsthe forth authordon't wikilinktypelinealiases givenlaslabellast name descriptionthe surnamethe fifth authordon't wikilink use authorlinkinsteadaliasesauthor surnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe fifth authordont wikilintype linealiases givenlastlabellast namedescriptionthe surname the sixth author don't wikilinkuse authorlinkinsteadaliasesauthorsurnametypelinefirstlabelfirst name descriptiongiven or first name middle namesor initialsthe sixth authordon't wikilinktypelinelastlabellast name descriptionthe surname the seventh author don't wikilinkuse authorlink'insteadaliasesauthorsurnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe seventh authordon't wikilink typelinealiasesgivenlastlabellast name descriptionthe surname the eighth authordon't wikilinkuse authorlink' insteadaliasesauthorsurnametypelinefirslabelfirst name descriptiongiven or first name, middle namesor initials the eighth author dont wikilinktypelinealiasesgivenlastlabellast namedescriptionthe surnamethe ninth authordont wikilinkuseauthorlinkinsteadif nine authors are definedthen only eight will show and et alwill show in place the last authoraliasesauthorsurnametypelinefirslabelfirst namedescriptiongiven or first name middle names or initials the ninth authordont wikilinktype": linealiasesgivenauthor-linklabelauthor linkdescriptiontitleexisting Wikipedia article about the author can suffix with a numeral to add additional authorstypewikipagenamealiasesauthorlinkauthorlinkauthorlinkauthorlinlabelauthor link descriptiontitle existing Wikipedia articlethe second authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabel author link descriptiontitle existing wikipedia article about the third authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabelauthor linkdescriptiontitle existing wikipedia article about the forth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinlabelauthor linkdescriptiontitle existing wikipedia articlethe sixth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinlabelauthor linkdescriptiontitle existing Wikipedia article about the sixth authortypewikipagenamealiasesauthorlinkauthorlinkautholinklabelauthorlinkdescriptiontitle existing Wikipedia articlethe seventh authortypewikipagenamealiasesautholinkauthorlinkauthorlinklabelauthor lindescriptiontitle existing Wikipedia article about the eighth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabelauthor lindescriptiontitle existing Wikipedia articlethe ninth authortypewikipagenamealiasesautholinkauthorlinorigyearlabeloriginal yeadescriptionoriginal year publicationprovide specificstypenumberaliasesorigyeartranstitlelabeltranslated titledescriptionan english language titleif the source cited is in a foreign languagelanguage is recommendedtypecontenttranschapterlabeltranslated chapter titledescription an English language chapter title if the source cited is in a foreign languagelanguageis recommendedtypecontenttypelabeltypedescriptionadditional information the media typethe sourceformat in sentence casetypecontentarchiveurllabelarchive urldescriptionthe url an archived copy a web pageif or in case the URL becomes unavailablerequiresarchivedatetypelinealiasesarchiveurlserieskabelseriesdescriptionseries identifier when the source is part a seriessuch as a book series or a journalaliasversiontypecontentaliasesversionworklabelworkdescriptionname the work in which the cited title is foundtypestringaliasesjournalwebsitenewspapermagazineencyclopediaencyclopaediadictionarymailinglistperiodicalvolumelabelvolumedescriptionfor one publication published in several volumestypelinesuggestedtrueissuelabel issuedescriptionissue numbertypestringaliasesnumberpagelabelpagedescriptionpage in the source that supports the contentdisplaysafterptypelinepages labelpagesdescriptionpages in the source that support the contentot an indication the number pages in the source; displays afterpptypelinesuggestedtrue labelatdescriptionmay be used insteadpageopageswhere a page number is inappropriate or insufficienttypelinenopplabeldescriptionset toyto suppress thepor ppdisplay with pageor pages when inappropriatesuch asfront cover typelinechapterlabelchapterdescriptionthe chapter heading the sourcetypestring contributionlabelcontributiontypestringrequiredchapterurllabelchapterurltypestringrequiredaliaseschapterurcontributionurllabelcontributionurltypestringrequired chapterformatlabelchapterformattypestringrequiredotherslabelotherstypestringrequireddescriptionFreetext field for people involved in creating a work who cannot be added with another name parameter such as author or editoreditionlabeledition descriptionWhen the publication has more than one edition for examplendrevisedetcsuffixed with edtypelineplacelabellocation publication descriptiongeographical place publicationusually not wikilinkedtypestringaliaseslocationpublicationplacelabelplacepublicationdescriptionpublication place shows after titleifplace orlocation are also given they are displayed before the title prefixed withwritten attypecontentpublisher labelpublisherdescriptionname the publisherdisplays after titletypecontentlanguagelabellanguagedescriptionthe language in which the source is writtenif nt english use the full language namedo not use icons or templatestypecontent formatlabelformatdescriptionformat the work referred to byurlurlis required when usingformat examplespdfdocxlsdo not specify hTmLtypecontentarxivlabelarXiv identifierdescriptionan identifier for arXive electronic preprintsscientific paperstypelineasinlabelasundescriptionamazonstandard identificationnumber characterstypelinealiasesasinasintld labelasintlddescript toplevel domain foramazon sites other than theustypelinebibcodelabelbibcode descriptionvibliographicreference code refcodecharacterstypelinebiorxiv labelbiorxivdescriptionbiorxiv identifierdigitstypelineciteseerxlabelciteseerxdescriptionciteseerx identifierfound after thedoiquery parametertypelinedoilabeldoidescriptiondigital object identifierbegins withtypestringaliasesdoibrokendatelabeldoi broken datedescriptionthe date that the doi was determined to be brokentypedateisbnlabelisbndescriptioninternationalstandard book bumberuse thedigitwhere possibletypeline issnlabelissndescriptioninternationalstandardserialnumberprint charactersusually split into two groupsfour using a hyphentypelineeissnlabeleissndescriptioninternational standard serialnumberonline charactersusually split into two groups four using a hyphentypelinejfmlabeljfm codedescriptionjahrbuchuber die fortschritte der mathematik classification codetypelinejstorlabeljstordescriptionjstor identifiertypelinelccnlabellccndescriptionlibrary congress control numbertypelinemrlabelmrdescriptionmathematical reviews identifiertypelineoclclabeloclcdescriptiononlinecomputelibrary center numbertypenumberollabeloLdescriptionopen library identifiertypelineosti labelostIdescriptionofficescientific and Technical Information identifiertypelinepmclabelpmcdescriptionpubmedcenter article numbertypenumberpmidlabelpmiddescriptionPubmed unique Identifiertypelinerfclabelrfcdescriptionrequest for com ments numbertypenumberssrnlabelssrndescriptionsocial scienceresearch networktypelinezbllabelzb descriptionzentralblatt math journal identifietypelineidlabeliddescription unique identifier used where none the specialized ones are applicabletypelinequotelabelquotedescriptionrelevant text quoted from the source displays last enclosed in quotesneeds to include terminating punctuationtypecontentreflabelrefdescriptionan anchor identifiercan be made the target wikilinks to full referencesspecial value harv generates an anchor suitable for the harv and sfn templatestypelineaccessdatelabelur access datedescriptionthe full date when the original url was accessed do not wikilinktypedatealiasesaccessdatelaysourcelabellay sourcedescriptionname the source the laysummarydisplays in italics preceded by an en dashtypestringaliaseslaysourcelaydatelabellay datedescriptiondatthe summarydisplays in parenthesestypedatealiaseslaydatearchivedatelabelarchive datedescriptiondate when the original url was archived do not wikilinktypedatealiasesarchivedateeditorlastlabeleditor last namedescriptionthe surname the editordont wikilink use editorlink can suffix with a numeral to add additional editoaliaseseditoreditorsurnameeditorlasteditorsurnameeditoreditorlasteditorsurnameeditorseditorfirstlabeleditor first namedescriptionthe surnamethe editordont wikilinkuse editorlinkcan suffix with a numeral to add additional editorsaliaseseditorfirsteditorgiven editorfirsteditorgiveneditorlastlabeleditor last name descriptionthe surnamethe second editordon't wikilinkuseeditorlinkeditor first namedescriptiongiven or first name, middle names or initials the second editordont wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last name descriptionthe surname the third editor don't wikilinkuseeditolinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven orfirst name middle names or initialsthe third editordon't wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last namedescriptionthe surnamethe fourth editordon't wikilinkuseeditorlinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven or first name middle names or initialsthe fourth editordont wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last namedescriptionthe surname the fifth editor don't wikilink use editolinkaliaseeditortypelineeditofirslabeleditor first namedescriptiongiven or first name middle names or initialsthe fifth editordont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surnamethe sixth editondon't wikilinkuse editorlinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven or first name middle names or initialsthe sixth editordont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surname the seventh editordont wikilinkuse editorlinkaliaseseditortypelineeditorfirstlabeleditor first name descriptiongiven or first name middle names or initialsthe seventh editor dont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last namedescriptionthe surnamethe eighth editordont wikilinkuseeditorlinkaliaseseditortypelineeditofirstlabeleditor first namdescriptiongiven or first namemiddle namesor initialsthe eighth editordon't wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surnamethe ninth editor dont wikilink useeditorlinkaliaseseditortypelineeditorfirstlabeleditor first name descriptiongiven or first name middle namesor initials the ninth editordont wikilinktypelinealiaseseditorgiveneditorlinklabeleditorlinktypestringrequirededitolink labeleditorlinktypestringrequired editorlinklabeleditorlinktypestringrequirededitolinklabeleditorlinktypestringrequirededitolinklabeleditorlinktypestringrequiredtranslatorlastlabeltranslator last name descriptionthe surnamethe translatodont wikilink usetranslatorlinkcan suffix with a numeral to add additional translatorsaliasestranslatortranslatorlastranslatortranslatorlasttypestringtranslatorfirstlabeltranslator first namedescriptiongiven or first name, middle namesorinitialsthe translatordont wikilinkuse translatorlinkcan suffix with a numeral to add additional translatorsaliasestranslatorfirsttranslatorfirst1typestringtranslatorlinklabeltranslator linkdescriptiontitle existing Wikipedia article about the translatorcan suffix with a numeral to add additional translatorstypewikipagenamealiasestranslatorlinktranslatorlinktranslatorlaslabeltranslator last namedescriptionthe surnamethe second translatordont wikilinkusetranslatorlinkaliasestranslatortranslatorlasttype stringtranslatorfirslabeltranslator first namdescriptiongiven or first name middle namesor initials the second translatordon't wikilinkuse translatorlinkaliasestranslatorfirsttypestringtranslatorlast labeltranslator last namdescriptionthe surnamethe third translatordont wikilink use translatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirstlabeltranslator firstname,descriptiongiven or first name,middle namesor initialsthe third translator dont wikilinkusetranslatorlinkaliases translatorfirsttypestringtranslatorastranslator last name descriptionthe surnamethe fourth translatordont wikilinkuse translatorlinkaliasestranslatortranslatorlast typestringtranslatorfirstlabeltranslatorfirst namedescriptiongiven or first namemiddle namesor initials the fourth translatordon't wikilinkuse translatorlinaliasestranslatorfirsttypestringtranslatorlastlabeltranslator last namedescriptionthe surname the fifth translatordont wikilinkusetranslatorlinkaliasestranslatortranslatorlaststringtranslatorfirslabeltranslator first name descriptiongiven or first namemiddle namesor initials the fifth translatordont wikilink use translatorlinkaliasestranslatorfirsttypestringtranslatorlaslabeltranslator last namedescriptionthe surnamethe sixth translatordon't wikilinkusetranslatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirslabeltranslator first namedescriptiongiven or first name middle namesor initialsthe sixth translatordont wikilinkuse translatorlinkaliasestranslatofirsttypestringtranslatorlastlabeltranslator last namedescriptionthe surnamethe seventh translatordon't wikilinkusetranslatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirslabel translator firstnamedescriptiongiven or first name middle namesor initialsthe seventh translatordont wikilinkusetranslatorlinkaliasestranslatorfirsttypestringtranslatorlalabeltranslatorlast namedescriptionthe surname the eighth translatordont wikilinkusetranslatorlinkaliases translatortranslatorlasttypestringtranslatorfirslabeltranslator first namedescriptiongiven or first name middle namesorinitialsthe eighth translatordont wikilink use translatorlinkaliasestranslatorfirsttypestringtranslatorlaslabeltranslatorlast name descriptionthe surname the ninth translatordon't wikilinkuse translatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirst: labeltranslator first namdescriptiongiven or first name middle names or initials the ninth translatordon't wikilinkusetranslatorlinkaliasestranslatorfirsttypestringtranslatorlinklabeltranslatorlink descriptiontitleexisting Wikipedia articlethe second translator typewikipagenamealiasestranslatorlinktranslatorlinlabeltranslator linkdescriptiontitleexisting Wikipedia articlethe third translatortypewikipagenamealiasestranslatorlinktranslatorlinlabeltranslatorlinkdescriptiontitleexisting Wikipedia article aboutthe fourth translatortypewikipagename aliasestranslatorlinktranslatorlinlabektranslator linkdescriptiontitleexistingwikipedia article about the fifth translatortypepagenamealiasestranslatorlinktranslatorlinlabeltranslator linkdescriptiontitleexisting Wikipedia articlethe sixth translatortypewikipagenamealiasestranslatolinktranslatorlinlabeltranslator linkdescriptiontitleexistingarticlethe seventh translatortypepagenamealiasestranslatolinktranslatorlinlabeltranslatorinkdescriptiontitle existing Wikipedia article about the eighth translatortypepagenamealiasestranslatolinklinlabellindescriptiontitle existing Wikipedia article about the ninth translatortypewikipagenamealiases translatorinklayurlaliases layurllabellay urldescriptionurllink to a nontechnical summary or review the sourcetypelinedisplayauthorlabeldisplay authorsdescriptionnumber authors to display beforeet alis used must be less than the number listedtypenumbernameliststylealiases namelistformatlabelbame list styledescriptionsets the style for the listacceptsampandandvanc amp displays an ampersand after the penultimate nameand the same withand and vanc displays in Vancouver formattypestringmapscitoid editioneditiontitletitlecasenametitlenameacttitleurlurllabelpublishercompanypublisherstudiopublishernetworkpublisherdistributorpublisherpublisherpublisherpublicationtitleworkdictionarytitleworkencyclopediatitleworkbooktitleworkdatedatedateenacteddatedateDecideddateaccessdateaccessdateplaceplace issndoidoilanguagelanguagepodcastercontributorothersauthorfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlasttranslatortranslatorfirsttranslatorlasttranslatorfirsttranslatorlastranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirst translatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlastranslatorfirsttranslatorlasteditoreditorfirsteditorlasteditofirsteditolasteditofirsteditolasteditofirsteditolastparamorderlastfirsttitledateurlworkvolume issuepagepagespublicationdatedfyearpostscripteditorlasteditorfirst authormaskorigyeartranstitletranschaptertypearchiveurlseriesat noppchaptercontributionchapterurlcontributionurlchaptertotherseditionplacepublicationplacepublisherlanguageformatarxivasinasintldbibcodebiorxivciteseerxdoidoibrokendateisbnissneissnjfmjstorlccnmroclcolostipmcpmidrfc ssrnzblidquoterefaccessdatelayurlaysourcelaydatenameliststyledisplayauthorsarchivedatelastfirslasfirslasfirstlastfirstlast firslasfirslasfirslasfirsauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkeditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlinkeditorlinkeditorlinkeditorlinkeditorlinktranslatorlasttranslatorfirsttranslatorlinktranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatolasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlinklinktranslatorlinktranslatorlinktranslatorlinktranslatorlinktranslatorlinktranslatorlitemplatedata cosee alsowikipediacitation templateswikipediainline citationwikipediaparenthetical referencing foracomparisoncitations using templates withcitations written freehandseewikipediaciting sourcesexample edits for different methodsfootnoteswikipediaciting sourcesexample edits for different methodsnbspdootnotes botesreflist wikipedia referencingwikipedia help pages includeonlysandbox other categories go below thislinepleaseinterwikis go to Wikidatathank youcategorycitation styletemplatesincludeonly




