Template:Citation/doc: Difference between revisions

From All Skies Encyclopaedia
No edit summary
imported>Moonythedwarf
m (Reverted edits by 2804:D55:52C7:F200:7C2E:30CD:A137:DF10 (talk) to last version by DavidBrooks)
Line 1: Line 1:
documentation subpage
{{Documentation subpage}}
<!-- Categories go where indicated at the bottom of this page, please; interwikis go to Wikidata (see also: [[Wikipedia:Wikidata]]). -->
categories go where indicated at the bottom this pagepleaseinterwikis go toWikidatasee alsowikipediawukidataforthenbspcitation neededtemplatetlcitation neededifeqpagenamehootpagenamecascadeprotected templateifeqpagenamerootpagenanehighrisk189000csdoclualua
{{for2|the{{nbsp}} {{fake citation needed}} template|{{tl|citation needed}}}}
thecitationtemplate generates a citation for a bookperiodicalcontribution in a collective work or a web page it determines the citation type by examining which parameters are used as with other citation templatesthis template can be used either in a footnotebetweentagreftagsor in a section that lists sourcesthis template uses the same lualuacode ashelpcitationstylecitation style templates with parameters to change the displayed format tohelpcitationstylecitation style
{{#ifeq: {{PAGENAME}}|{{ROOTPAGENAME}}|{{Cascade-protected template}}}}
if the correct parameters are used this template produces output identical to thatthe cite templates such as tl cite book andty cite webwith one important exceptionby defaultthis citation template uses commas in places where the cite templates use periods full stops by default either type template can use periodsfull stops or commas by using an optional parameter regardlesswhich citation templates are used or even if none are used at allall citations should have the same format throughout an article in the savedrendered text
{{#ifeq: {{PAGENAME}}|{{ROOTPAGENAME}}|{{High-risk|189000+}}}}
noteall parameternames must belowercasesimple citation
{{csdoc|lua|lua=yes}}
this section covers the most com monly used parameters you can copy the horizontal form or vertical form below and then add in extra parameters from the full listspacing and orderingthe parameters within the template is irrelevant and does not affect the final rendered textcodenowiki citation lastfirstyeartitlepublisherpublicationplacepageuraccessdatenowikicodeclasswikitableprecitation
The '''Citation''' template generates a citation for a book, periodical, contribution in a collective work, or a web page. It determines the citation type by examining which parameters are used. As with other citation templates, this template can be used either in a footnote (between {{tag|ref}} tags) or in a section that lists sources. This template uses the same [[WP:Lua|Lua]] code as [[help:Citation Style 1|citation style 1 (CS1)]] templates with parameters to change the displayed format to [[help:Citation Style 2|citation style 2 (CS2)]].
lastfirstyeartitlepublisher publicationplacepageurl accessdatepre

lastthe authors surname or last namedont use with theauthorparameterfirstthe author's first or given name(s)yearyear authorship or publication mandatory for use with links fromtemplateharvard citationunlessparadatespecifies both month and yeartitleitlethe work mandatory for web references
If the correct parameters are used, this template produces output identical to that of the Cite templates, such as {{Tl|Cite book}} and {{Tl|Cite web}}, with one important exception: By default, this Citation template uses commas in places where the Cite templates use periods (full stops) by default; either type of template can use periods (full stops) or commas by using an optional parameter.
publisherthe name the publisheromit terms such as publisherscoincktdetcbut retain the wordsbooksor pressnot normally included where the publication is a periodical which has its own wikipedia articleeg newsweekbillboarmagazinebillboard]publicationplaceorplaceorlocationthe citypublication if more than one town city is listed on the title page give the first one or the locationthe publisher's head office omit when the publication is a periodical whose name specifies the location e gthe new york times the times india pageFor use when one page is cited adds pbefore the page number do not use with pagesurlauniform resource locator urlan online location where the item can be found if the url includes double quotes these must be encoded asaccessdatedateref groupn namedateswhen the url was accessedexampleclasswikitableprecitationlastturnerfirstorsamus

titlehistorythe pioneer settlement
Regardless of which citation templates are used or even if none are used at all, all citations should have the same format throughout an article in the saved, rendered text.
phelps and gorham's purchaseand morrisreservepublisherwilliam alling

placerochesternewyorkyear 1851ol7120924Wprecitation
Note: All parameter names must be [[lowercase]].
lastturnerfirstorsamustitlehistory the pioneer settlement phelps and gorhams purchase and morris reserve

publisherwilliamalling
==Simple citations==
placerochesternew york
This section covers the most commonly used parameters. You can copy the horizontal form or vertical form below and then add in extra parameters from the full list. Spacing and ordering of the parameters within the template is irrelevant and does not affect the final, rendered text.
year1851ol7120924wfull citation parametersnoticethis section needs to be edited it includes deprecated parameters and does not include parameters that were added in the updatesthese can be used for all types publicationallare optional and indentation is used simply to group related items&nbspthese may be mutually exclusive where indicated. some hyphenated names can also be placed without hyphensclasswikitableprecitation

authorlastfirst author last first author link author link authorseparator author name separator author mask displayauthorseditoreditor last editorfirsteditoreditorlast editorfirst editorlinkeditorlink translatorlasttranslatorfirsttranslatorlink translatorlast translatorfirst translatorlinkothers publicationdatedateyearorigyeartitle chapterchapterur chapterformatcontribution contributionurtype journalperiodicalnewspapermagazine encyclopediaworkeditionseriesvolume issuepublisherpublicationplace place
<code><nowiki>{{Citation |last= |first= |year= |title= |publisher= |publication-place= |page= |url= |access-date=}}</nowiki></code>
languagepagepagesnoppatidisbnissnoclcpmid pmcbibcodedoi doiinactive date

zbl
{| class="wikitable"
urlaccessdate
|-
format
| <pre>{{Citation
archiveurl
| last =
archivedate
| first =
urlstatus
quote
| year =
| title =
layurl
| publisher =
laysource
| publication-place =
laydateseparator postscriref preparameterssyntaxcsdocsyntaxluacsdocsepcommaluaacsdoccoinsluaswhats newcsdocwhats newdeprecatedcsdocdeprecatedluadescriptionauthorscsdocauthorluacontributoryesothersyeseditorscsdoceditorlua
| page =
titlecsdoctitleluatitleformatitalicscsdocchapterluacsdoctypelua
| url =
csdoclanguagelua
| access-date =
datecsdocdateluawork
}}</pre>
csdocjournalluapublishecsdocpublisherluaeditionseriesvolumecsdocedition|luacsdocseriesluacsdocvolumeluainsource locationscsdocpagesluaurlanchorurcsdocurlchapteranchorchapterurcsdocchapterurlluaanchor
|}
csdocrefluaidentifiersanchoridcsdocidlua
* '''last''': The author's surname or last name. Don't use with the '''author''' parameter.
anchoridcsdocidluaquotecsdocquoteluacslaysummarycsdoclaydisplay optionscsdocdisplayluanosubscription or registration requiredcsdocregistrationluaexamplesbooksclasswikitablethree authorsa volumeand an editionampersandampforced before final authors nameprecitation
* '''first''': The author's first or given name(s).
lastlincolnfirstalastwashingtonfirst glastadamsfirstjnameliststyle amptitleall thepresidentsnames
* '''year''': Year of authorship or publication. Mandatory for use with links from [[:Template:Harvard citation]], unless {{para|date}} specifies both month and year.
publisherthe pentagon
* '''title''': Title of the work. Mandatory for web references.
placehomebasenewyorkvolume xiieditionndyear 200precitationlastlincolnfirstlast washingtonfirstg
* '''publisher''': The name of the publisher. Omit terms such as ''Publishers'', ''Co.'', ''Inc.'', ''Ltd.'', etc., but retain the words ''Books'' or ''Press''. Not normally included where the publication is a periodical which has its own Wikipedia article (e.g. ''[[Newsweek]]'', ''[[Billboard (magazine)|Billboard]]'').
lastadams
** '''publication-place''' (or '''place''' or '''location'''): The city of publication. If more than one town/city is listed on the title page, give the first one or the location of the publisher's head office. Omit when the publication is a periodical whose name specifies the location (e.g. ''The New York Times'', ''The Times of India'')
firstj
* '''page''': For use when one page is cited. Adds "p." before the page number. Do not use with '''pages'''.
nameliststyleamp
* '''url''': A [[Uniform resource locator|url]] of an online location where the item can be found. If the url includes double quotes, these must be encoded as "%22".
titleallthepresidents namespublisherthepentagonplace home basenewyork
** '''access-date''': Date<ref group="n" name="dates" /> when the url was accessed.
volume xiieditionndyear2007webclasswikitablewebpageprecitationurl httpnrhpfocusnpsgovtitle npsfocusworknationalregister oHistoric placespublishernationalpark serviceaccessdatenovember302010ref noneprecitationurlhttpnrhpfocusnpsgovtitle nps focusworknational registerhistoric placespublishernationalpark serviceaccessdatenovember302010ref none

archived pageprecitatio url httpliftoffmsfcnasagovacademyspaceatmospherehtmltitleearth's Atmosphereaccessdateoctober 25 2007 publishernational aeronautics and space administration]year 1995authornassaarchiveurl httpwebarchiveorgweb20071013232332http
===Example===
liftoffmsfcnasagovacademyspaceatmospherehtmlarchivedateoctober 13 200precitationurl httpliftoffmsfcnasagovacademyspaceatmospherehtmltitleearth's atmosphereaccessdateoctober 252007publishernationalaeronautics and space administration year1995 authornassaarchiveurl httpwebarchiveorgweb20071013232332httpliftoffmsfcnasagovacademyspaceatmospherehtmlarchivedateoctober 13 2007journalsnewspapersmagazines or other periodicalsclasswikitablejournal article
{| class="wikitable"
precitationlasthillfirstmarvin s
|-
titlejosephsmithandthe1826
| <pre>{{Citation
trialnew evidence and new
| last = Turner
Difficultiesjournalbyustudies
| first = Orsamus
volume issueyear197pages18url httpbyustudiesbyuedushoppDFSRC122hillpdf
| title = History of the pioneer settlement of
prcitationlasthillfirsrmarvin stitle joseph smith and the 1826 trialnew evidence and new difficultiesjournal byu studiesvolume12issueyear1976pages 18
Phelps and Gorham's purchase, and Morris' reserve
urlhttpbyustudiesbyuedushoppdfsrc122hillpdfJournalarticle with multiple authors and identifier
| publisher = William Alling
precitation lastmandelkern
| place = Rochester, New York
firstmlasteliasfirstjlastedenfirst dlastcrothersfirstddisplayauthors title the dimension dna in solutionjournal h mol biolvolume 152issue pages 153161year1981pmid7338906
| year = 1851
doi1010160022283681900991
| ol = 7120924W
precitationlastmandelkern
}}
firstmlaseliasfirsjlasedenfirsdlas crothersfirsddisplayauthorstitlethe dimensions dnain solutionjournaljmolbiovolume 152issuepages153161year1981pmid 7338906
</pre>
doi1010160022283681900991newspaper articleprecitationlastsmithfirstjoseph authorlinkjosephsmith
| {{Citation
titlelasttestimonysister emmanewspaperthesaintsheraldlocationplanoilvolume 26issue19dateoctober11879page289url httpwwwsidneyrigdoncomdbroadhu
| last = Turner
ilsain1872htm100179precitation
| first = Orsamus
lastsmithfirstjoseph
| title = History of the pioneer settlement of Phelps and Gorham's purchase, and Morris' reserve
authorlinkjosephsmith
| publisher = William Alling
titlelast testimony sister emma
| place = Rochester, New York
newspaperthesaintsheraldlocationplanovolume26issue19dateoctober 1879page289url httpwwwsidneyrigdoncomdbroadhuilsain1872htm100179conference papers and public lecturesclasswikitable
| year = 1851
conference paperprecitation
| ol = 7120924W
lastsullivanfirstdb
}}
contributiontime and frequency measurementatnistthe first 100 yearsyear2001title2001 ieee int'l frequency controlsymppublishernational institutestandards and technologycontributionurl httptfnistgovtimefreqgeneralpd1485pdprecitationlastsullivanfirst dbcontributiontime and frequency measurement at nistthe first 100 yearsyear2001title 2001 ieeeintfrequency control symppublishernational institute standards and technology
|}
contributionurl httptfnistgovtimefreqgeneralpd1485pdlectureprecitationlast habichtfirstchristiancontribution hellenisticathens and her philosophersyear1988titledavid magie lectureprinceton university program in the historyarchaeology and religionsthe ancientworldpublisher princeton universitpagepre

citationlasthabichtfirst christiancontributionhellenistic athens and her philosophers
==Full citation parameters==
year1988titledavidmagielecture princeton university program in the historyarchaeologyand religionsthe ancient worldpublisherprinceton universitypagepartsbooksincluding encyclopedia articlesclasswikitable
{{notice|This section needs to be edited. It includes deprecated parameters and does not include parameters that were added in the updates.}}
manuscript published in an edited compilationprecitationlastbidamonfirst emma smithauthorlinkemma Hale smithchapterletter to emma s pilgrimdatemarch 271876editorlast vogeleditorfirstdantitle early mormon documentsvolumepublisher signature vooks
These can be used for all types of publication. All are optional and indentation is used simply to group related items&nbsp;— these may be mutually exclusive where indicated. Some hyphenated names can also be placed without hyphens.
publicationdate 1996

isbn1560850728precitationlast bidamonfirst emma smithauthorlinkemma hale smithchapterletter to emma s pilgrimdate march 271876editorlast vogeleditorfirstdantitleearly mormon documentsvolumepublishersignaturebookspublicationdate1996isbn 1560850728work with an editor but no authorprecitationeditorlast vogeleditorfirstdantitleearly mormon documentsvolume publishersignature booksdate1996
{| class="wikitable"
isbn 1560850728precitationeditorlast vogeleditorfirstdantitle early mormon documentsvolumepublisher signature vooksdate1996isbn1560850728
|-
encyclopedia article by a named authorprecitationlastkramerfirst martinauthorlink martinkramer
| <pre>{{Citation
year1999titlebernard lewiseditorlastboydeditorfirst kelleyencyclopediaencyclopedia historians and historical writingvolumepages 719720location london
| author =
publisherfitzroydearbornurhttpwwwgeocitiescommartinkramerorgbernardlewishtmprecitationlastkramerfirst martinauthorlinkmartinkrameryear 1999titlebernard lewiseditorlast boydeditorfirstkelleyencyclopediaencyclopedia historians and historical writing
| last =
volume pages 719720
| first =
location londonpublisherfitzroy dearbornurl httpwwwgeocitiescommartinkramerorgvernardlewishtm
| author2 =
encyclopediaarticle with no named authorprecitation
| last2 =
titlebernardlewiseditorlast boyeditorfirstKelleyyear 1999
| first2 =
encyclopediaencyclopediahistorians
| author-link =
and historicalwritingvolumepages 719720
| author2-link =
publisherfitzroy dearborn
| author-separator =
locationlondonurl httpwwwgeocitiescommartinkramerorgvernardLewishtmprecitation
| author-name-separator =
title vernard lewis
| author-mask =
editorlast boyd
| display-authors =
editorfirst kelleyyear 1999encyclopedia encyclopedia historians and historical Writing
| editor =
volume
| editor-last =
pages719720location london
| editor-first =
publisherfitzroydearborn
| editor2 =
urlhttpwwwgeocitiescommartinkramerorgvernardLewishtmrepublications or edited quotations in a periodical articleclasswikitablemanuscript edited and published in a journal
| editor2-last =
precitationlastknight
| editor2-first =
first josepsryear1833editorlast jesseeeditorfirst deantitle joseph knights recollectionEarly Mormon history
| editor-link =
journalbyustudies
| editor2-link =
volume 17issuepublicationdate1976
| translator-last =
page35
| translator-first =
urlhttpbyustudiesbyuedushoppdfsrcjesseepdprecitationlastknightfirst josephsryear1833editorlast Jesseeeditorfirst dean
| translator-link =
titlejoseph knights recollection early mormonhistory
| translator2-last =
journalbyustudiesvolumeissue
| translator2-first =
publicationdate1976page 35urlhttpbyustudiesbyuedushopdfsrc17jesseepdf manuscript written at one date and placethen published in a periodical at a different date and place with commentary by the editorprecitation
| translator2-link =
lastklingensmithfirst philip
| others =
type affidavit
| publication-date =
date september 5 1872
| date =
place lincoln countynevadatitle mountain meadows massacreeditorlast toohyeditorfirstdennis jjournal corinne aaily reporterpublicationdate september 241872publicationplace corinne utah
| year =
volume issue252 pageurlhttpudnlibutaheduucorinne5359prcitationlastklingensmithfirstphiliptype affidavitdateseptember1872
| origyear =
place lincoln county nevada
title mountain meadows massacre
| title =
| chapter =
editorlast toohyeditorfirst dennisj
| chapter-url =
journalcorinne daily reporter
| chapter-format =
publicationdateseptember 24 1872publicationplacecorinneutah
| contribution =
volumeissue252pageurl http:udnlibutaheduucorinne5359press releaseclasswikitable
| contribution-url =
press release with quotation
| type =
precitatio urlhttpwwwapplecomprlibrary20100405padhtmtitleapple sells over 300,000 ipads first day
| journal =
publisherappleincaccessdateapril 2010quotein the us asmidnight saturdayaprilrefnonepre
| periodical =
citationurl httpwwwapplecomprlibrary201004ipadhtmltitleapplesells over 300,000 ipadsdirstday
| newspaper =
publisherappleincaccessdate april 102010
| magazine =
quotein the us asmidnight aturdayaprilrefnoneanchored citations
| encyclopedia =
thistemplate can generate a citation that can be combined with wpciteshortshortened footnotesorwikipediaparenthetical referencingparenthetical referencing it does this by creating an htnl element anchorhtml anchorcontaining an id the special parameterpara refharvgenerates ansuitable for harvard referencingtemplates such astlharvas specified in the next sectionthis is the default for the tlcitationtem plateto disable anchor generationspecifypararefnone you can also specify the r directly using thepararefvarvarparameterfor examplesuppose an article's referencessection contains the markupcodenowikicitationauthorsigmund freud titlecivilization and Its Discontentsdate1930refcivdisnowikicode
| work =
which generates the citationcitationauthorsigmund freudtitlecivilization and its discontentsdate1930refcivdis
| edition =
thenthe markupcodenowikicivdisfreud 1930nowikicode generates a parenthetical reference civdisfreud 1930containing a wikilink to the citationtry clicking on the wikilink
| series =
anchors forharvard referencing templates
| volume =
ids compatible with Harvard referencing templates such as tlharvare compute from the last names the authorsor editorsif no authors are givenand the yearthe cited source for examplethe markupcodenowikiharvwrightevans1851pix nowikicodegenerates the harvard referenceharvwrightevans1851pixwhich wikilinks to the citation whose markup and appearance are shown belowcodenowikicitationlastwrightfirstthomaslastevansfirstrhtitlehistorical and descriptive accountthe caricaturesjames gillraylocationlondonpublisherhenry gbohndate1851 oclc59510372nowikicodecitationlastwrightfirstthomaslastevansfirstrhtitlehistorical and descriptive account the caricaturesjames gillraylocationlondonpublisher=Henry gbohndate1851oclc=59510372
| issue =
In this example thetlcitation template definesand thetlharvtemplate uses the html idcodeciteref wrightEvans1851code composed by concatenating the stringcodeciterefcodewith the last namesthe authors and the yearthe tlharvidtemplate can be used to generate such idsfor examplecodenowikiharvidwrightevans1851nowikicode generatescodeharvidwrightevanscode
| publisher =
related methods which leave only a number in the text are to use the tlharvnbtemplate enclosed in the nowikirefrefnowikihtml codeor to use thetlsfntemplate alonethe example above would be codenowikirefharvnbwrightevans1851p=ixrefnowikicodeorcodenowiksfnwrightevans1851pixnowikicode both which generate a foot such as17harvnbwrightevans1851pix
| publication-place =
the names only the first four authors are usedother author names are not concatenated to theif no author names are giveneditor names are used instead
| place =
last names are usedas specified by the parametersparalastor paralastparalastparalastand paralastand similarly for paraeditorlastetcand for parainventorlastetcif a full name is given but no last name is specified, this template falls back on the full namebut this usage is not recommendedfor exampleincodenowikicitationauthorsigmund freudtitlethe ego and the iddate1923nowikicodeno last name is givenso this citation cannot be combined with the harvard reference codenowikiharvdreud1923nowikicode to make thesetlcitationand tlharvinvocations compatibleeither replaceparaauthorsigmundfreudwithparafirstsigmundparalastfreudor add pararefnowikiharvidfreud1923nowikito thetlcitationinvocationor add the same ref parametersaypararefegoIdto both the tlcitationand the tlharvinvocationsthis paragraph appears to be outdated and probably needs to be updated to reflect currentcscsfunctionalitysimilarlythe year is usedas specified byparayearif no year is given this template attempts to derive the year fromparadateorif no date is givenfrom parapublicationdate by applying themwhelpextensionparserfunctionstimenediaWikinbsptimefunctionthis heuristic works with most common date formatsamericaninternational andiso8601calendar datesiso8601 standard formatas listed in wpmosbut may not work as expected with other formatsso when in doubt it may be safer to use parayear
| language =
ids must be unique
| page =
Namesyearsand handspecified ids must be chosen so that the ids are unique within a pageotherwise the html will not conform to the wc standardsand any references to the citations will not work reliablyfor examplesuppose a page contains the following two citations withtlharvcompatibleids:
| pages =
citationlastmontesfirstglasthaltermanfirstjsdate2008ajournalpediatricsvolumeissuepagese821e826titleassociationchildhoodautismspectrumdisorders and Lossfamily incomedoi101542peds20071594pmid18381511urlhttppediatricsaappublicationsorgcgicontentfull1214e821citationlastmontefirstlasthaltermanfirstjsdate2008bjournapediatricsvolume122issue=1pagese202e208titlechild care problems and employment among families with preschoolagedchildren with Autism in the united statesdoi101542peds20073037pmid18595965urlhttppediatricsaappublicationsorgcgicontentfull1221e202ifthese citations were altered to say2008 rather than2008aand2008bthe resulting page would not workbecause the two different citations would both attempt to use the idcodecitwrefnonteshalterman2008codeto avoid this problemdistinguish the citations by appending suffixes to the yearsegparadate2008aand paradate2008b as was done aboveany harvard references to these citations should use years with the same suffixesit is good practice to verify that a page does not contain duplicateids by usingthew3cmarkup validationserviceseeexternal linksexternallinksdates
| nopp =
reflistgroupnrefsref namedatesgroupnthe formatf dates in the referencesan article should use consistent and unambiguous stylesexample formats used in Wikipediacitations include200920090914iso8601calendar datesiso8601standard format
| at =
september2009septemberwith comma
| id =
septemberdates should not be linked sayto a wikipedia article the same name in referencesplease seeWikipediamanualstyledates and numbersdateswikipediananualstyle dates and numbersnbspdatesfor more guidanceformatting datesref
| isbn =
tools
| issn =
seewikipediaxiting sourcescitation templates and toolswikipediaciting sourcesnbspcitation templates and toolsfor a list tools that can help create a reference in thecitationformattemplatedata
| oclc =
noticethis template data section needs to be edite dit includes deprecated parameters and does not include parameters that were added intheluaupdatestemplatedata headertemplatedatdescriptionthe citation template generates a citation for a bookperiodicalcontribution in a collective workor a web pageit determines the citation type by examining which parameters are useparamslastlabellastnamedescriptionthe surnamethe author don't wikilinkuseauthorlinkinsteadcan suffix with a numeral to add additional authorsaliasesauthoauthorlasttypelinesuggestedtruefirstlabelfirst namedescriptionfiven or first name middle namesor initialsthe authordon't wikilinkuseauthorlinkinsteadcan suffix with a numeral to add additional authorsaliasesfirsttypelinesuggestetruetitlelabeltitlsourcetypestrindescriptiontitlesourceworks display in italics and articles surrounded in quotation marksrequiredtruedate
| pmid =
labeldate sourcetypestringdescriptionfull datesource being referenced in the same format as other publication dates in the citations do ot wikilinkdisplays after the authors and enclosed in parenthesesif there is no authorthen displays after publisherurllabelurk sourcetypestrindescriptionurl an onlinelocation where the textthe publication can be foundpublicationdatelabelpublication datetypestringrequireddescription datepublication when different from the date the work was written. Displays only ifyear or date are defined and only if differentelse publicationdate is used and displayed as dateuse the same format as other dates in the articledo ot wikilinkfollows publisherif work is not definedthen publication-date is preceded bypublished and enclosed in parenthesisdflabeldatedormadescriptionsets rendered datesto the specified formattypestringyearlabeltear publicationdescriptionyear the source being referencedrecommended only when date parameter format is yymd and a citerefmbiguator is neededtypenumberpostscriptlabelpostscripttypestringrequireddescriptioncontrols the closing punctuation for a citationdefaults to a period for no terminating punctuation specifypostscriptnone leavingpostscriptempty is the same as omitting itbut is ambiguousignored if quote is definedauthormasklabelauthor masktypestringrequiredaliases authormaskdescriptionreplaces the name the first author with em dashes or textset authormask to a numeric value n to set the dash n em spaces wideset author mask to a text value to display the text without a trailing author separatorfor examplewithyou must still include the values for all authors for metadata purposesprimarily intended for use with bibliographies or bibliography styles where multiple works by a single author are listed sequentially such as shortened footnotesdotuse in a list generated by reflistreferencesor similar as there is no controlthe order in which references are displayedyou can also use editormask and translatormask in the same waylastlabellast namdescriptionthe surnamethe second authordontwikilinkuseauthorlink insteadaliasesauthorsurnametypelinefirslabelfirst namedescriptiongiven or first name middle namesor initialsthe second authordon't wikilinktypelinealiasesgivelaslabellast namedescriptionthe surnamethe third authordon't wikilinkuseauthorlinkinsteaaliasesauthorsurnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe third authordon't wikilinktypelinealiasesgivenlas labellastnamedescriptionthe surnamethe forth authordon't wikilinkuseauthorlinkinsteadaliases
| pmc =
authorsurnametypelinefirstlabelfirst name descriptiongiven orfirst name middle names or initialsthe forth authordon't wikilinktypelinealiases
| bibcode =
givenlaslabellast name descriptionthe surnamethe fifth authordon't wikilink use authorlinkinsteadaliasesauthor surnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe fifth authordont wikilintype linealiases givenlastlabellast namedescriptionthe surname the sixth author don't wikilinkuse authorlinkinsteadaliasesauthorsurnametypelinefirstlabelfirst name descriptiongiven or first name middle namesor initialsthe sixth authordon't wikilinktypelinelastlabellast name descriptionthe surname the seventh author don't wikilinkuse authorlink'insteadaliasesauthorsurnametypelinefirstlabelfirst namedescriptiongiven or first name middle namesor initialsthe seventh authordon't wikilink
| doi =
typelinealiasesgivenlastlabellast name descriptionthe surname the eighth authordon't wikilinkuse authorlink' insteadaliasesauthorsurnametypelinefirslabelfirst name descriptiongiven or first name, middle namesor initials the eighth author dont wikilinktypelinealiasesgivenlastlabellast namedescriptionthe surnamethe ninth authordont wikilinkuseauthorlinkinsteadif nine authors are definedthen only eight will show and et alwill show in place the last authoraliasesauthorsurnametypelinefirslabelfirst namedescriptiongiven or first name middle names or initials the ninth authordont wikilinktype": linealiasesgivenauthor-linklabelauthor linkdescriptiontitleexisting Wikipedia article about the author can suffix with a numeral to add additional authorstypewikipagenamealiasesauthorlinkauthorlinkauthorlinkauthorlinlabelauthor link descriptiontitle existing Wikipedia articlethe second authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabel author link descriptiontitle existing wikipedia article about the third authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabelauthor linkdescriptiontitle existing wikipedia article about the forth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinlabelauthor linkdescriptiontitle existing wikipedia articlethe sixth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinlabelauthor linkdescriptiontitle existing Wikipedia article about the sixth authortypewikipagenamealiasesauthorlinkauthorlinkautholinklabelauthorlinkdescriptiontitle existing Wikipedia articlethe seventh authortypewikipagenamealiasesautholinkauthorlinkauthorlinklabelauthor lindescriptiontitle existing Wikipedia article about the eighth authortypewikipagenamealiasesauthorlinkauthorlinkauthorlinklabelauthor lindescriptiontitle existing Wikipedia articlethe ninth authortypewikipagenamealiasesautholinkauthorlinorigyearlabeloriginal yeadescriptionoriginal year publicationprovide specificstypenumberaliasesorigyeartranstitlelabeltranslated titledescriptionan english language titleif the source cited is in a foreign languagelanguage is recommendedtypecontenttranschapterlabeltranslated chapter titledescription an English language chapter title if the source cited is in a foreign languagelanguageis recommendedtypecontenttypelabeltypedescriptionadditional information the media typethe sourceformat in sentence casetypecontentarchiveurllabelarchive urldescriptionthe url an archived copy a web pageif or in case the URL becomes unavailablerequiresarchivedatetypelinealiasesarchiveurlserieskabelseriesdescriptionseries identifier when the source is part a seriessuch as a book series or a journalaliasversiontypecontentaliasesversionworklabelworkdescriptionname the work in which the cited title is foundtypestringaliasesjournalwebsitenewspapermagazineencyclopediaencyclopaediadictionarymailinglistperiodicalvolumelabelvolumedescriptionfor one publication published in several volumestypelinesuggestedtrueissuelabel issuedescriptionissue numbertypestringaliasesnumberpagelabelpagedescriptionpage in the source that supports the contentdisplaysafterptypelinepages
| doi-inactive-date=
labelpagesdescriptionpages in the source that support the contentot an indication the number pages in the source; displays afterpptypelinesuggestedtrue
| zbl =
labelatdescriptionmay be used insteadpageopageswhere a page number is inappropriate or insufficienttypelinenopplabeldescriptionset toyto suppress thepor ppdisplay with pageor pages when inappropriatesuch asfront cover
| url =
typelinechapterlabelchapterdescriptionthe chapter heading the sourcetypestring contributionlabelcontributiontypestringrequiredchapterurllabelchapterurltypestringrequiredaliaseschapterurcontributionurllabelcontributionurltypestringrequired
| access-date =
chapterformatlabelchapterformattypestringrequiredotherslabelotherstypestringrequireddescriptionFreetext field for people involved in creating a work who cannot be added with another name parameter such as author or editoreditionlabeledition
| format =
descriptionWhen the publication has more than one edition for examplendrevisedetcsuffixed with edtypelineplacelabellocation publication descriptiongeographical place publicationusually not wikilinkedtypestringaliaseslocationpublicationplacelabelplacepublicationdescriptionpublication place shows after titleifplace orlocation are also given they are displayed before the title prefixed withwritten attypecontentpublisher
| archive-url =
labelpublisherdescriptionname the publisherdisplays after titletypecontentlanguagelabellanguagedescriptionthe language in which the source is writtenif nt english use the full language namedo not use icons or templatestypecontent
| archive-date =
formatlabelformatdescriptionformat the work referred to byurlurlis required when usingformat examplespdfdocxlsdo not specify hTmLtypecontentarxivlabelarXiv identifierdescriptionan identifier for arXive electronic preprintsscientific paperstypelineasinlabelasundescriptionamazonstandard identificationnumber characterstypelinealiasesasinasintld
| url-status =
labelasintlddescript toplevel domain foramazon sites other than theustypelinebibcodelabelbibcode
| quote =
descriptionvibliographicreference code refcodecharacterstypelinebiorxiv
| layurl =
labelbiorxivdescriptionbiorxiv identifierdigitstypelineciteseerxlabelciteseerxdescriptionciteseerx identifierfound after thedoiquery parametertypelinedoilabeldoidescriptiondigital object identifierbegins withtypestringaliasesdoibrokendatelabeldoi broken datedescriptionthe date that the doi was determined to be brokentypedateisbnlabelisbndescriptioninternationalstandard book bumberuse thedigitwhere possibletypeline
| laysource =
issnlabelissndescriptioninternationalstandardserialnumberprint charactersusually split into two groupsfour using a hyphentypelineeissnlabeleissndescriptioninternational standard serialnumberonline charactersusually split into two groups four using a hyphentypelinejfmlabeljfm codedescriptionjahrbuchuber die fortschritte der mathematik classification codetypelinejstorlabeljstordescriptionjstor identifiertypelinelccnlabellccndescriptionlibrary congress control numbertypelinemrlabelmrdescriptionmathematical reviews identifiertypelineoclclabeloclcdescriptiononlinecomputelibrary center numbertypenumberollabeloLdescriptionopen library identifiertypelineosti
| laydate =
labelostIdescriptionofficescientific and Technical Information identifiertypelinepmclabelpmcdescriptionpubmedcenter article numbertypenumberpmidlabelpmiddescriptionPubmed unique Identifiertypelinerfclabelrfcdescriptionrequest for com ments numbertypenumberssrnlabelssrndescriptionsocial scienceresearch networktypelinezbllabelzb descriptionzentralblatt math journal identifietypelineidlabeliddescription unique identifier used where none the specialized ones are applicabletypelinequotelabelquotedescriptionrelevant text quoted from the source displays last enclosed in quotesneeds to include terminating punctuationtypecontentreflabelrefdescriptionan anchor identifiercan be made the target wikilinks to full referencesspecial value harv generates an anchor suitable for the harv and sfn templatestypelineaccessdatelabelur access datedescriptionthe full date when the original url was accessed do not wikilinktypedatealiasesaccessdatelaysourcelabellay sourcedescriptionname the source the laysummarydisplays in italics preceded by an en dashtypestringaliaseslaysourcelaydatelabellay datedescriptiondatthe summarydisplays in parenthesestypedatealiaseslaydatearchivedatelabelarchive datedescriptiondate when the original url was archived do not wikilinktypedatealiasesarchivedateeditorlastlabeleditor last namedescriptionthe surname the editordont wikilink use editorlink can suffix with a numeral to add additional editoaliaseseditoreditorsurnameeditorlasteditorsurnameeditoreditorlasteditorsurnameeditorseditorfirstlabeleditor first namedescriptionthe surnamethe editordont wikilinkuse editorlinkcan suffix with a numeral to add additional editorsaliaseseditorfirsteditorgiven
| separator =
editorfirsteditorgiveneditorlastlabeleditor last name descriptionthe surnamethe second editordon't wikilinkuseeditorlinkeditor first namedescriptiongiven or first name, middle names or initials the second editordont wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last name descriptionthe surname the third editor don't wikilinkuseeditolinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven orfirst name middle names or initialsthe third editordon't wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last namedescriptionthe surnamethe fourth editordon't wikilinkuseeditorlinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven or first name middle names or initialsthe fourth editordont wikilinktypelinealiaseseditorgiveneditorlastlabeleditor last namedescriptionthe surname the fifth editor don't wikilink use editolinkaliaseeditortypelineeditofirslabeleditor first namedescriptiongiven or first name middle names or initialsthe fifth editordont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surnamethe sixth editondon't wikilinkuse editorlinkaliaseseditortypelineeditofirstlabeleditor first name descriptiongiven or first name middle names or initialsthe sixth editordont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surname the seventh editordont wikilinkuse editorlinkaliaseseditortypelineeditorfirstlabeleditor first name descriptiongiven or first name middle names or initialsthe seventh editor dont wikilinktypelinealiaseseditorgiveneditolastlabeleditor last namedescriptionthe surnamethe eighth editordont wikilinkuseeditorlinkaliaseseditortypelineeditofirstlabeleditor first namdescriptiongiven or first namemiddle namesor initialsthe eighth editordon't wikilinktypelinealiaseseditorgiveneditolastlabeleditor last name descriptionthe surnamethe ninth editor dont wikilink useeditorlinkaliaseseditortypelineeditorfirstlabeleditor first name descriptiongiven or first name middle namesor initials the ninth editordont wikilinktypelinealiaseseditorgiveneditorlinklabeleditorlinktypestringrequirededitolink
| postscript =
labeleditorlinktypestringrequired
| ref =
editorlinklabeleditorlinktypestringrequirededitolinklabeleditorlinktypestringrequirededitolinklabeleditorlinktypestringrequiredtranslatorlastlabeltranslator last name descriptionthe surnamethe translatodont wikilink usetranslatorlinkcan suffix with a numeral to add additional translatorsaliasestranslatortranslatorlastranslatortranslatorlasttypestringtranslatorfirstlabeltranslator first namedescriptiongiven or first name, middle namesorinitialsthe translatordont wikilinkuse translatorlinkcan suffix with a numeral to add additional translatorsaliasestranslatorfirsttranslatorfirst1typestringtranslatorlinklabeltranslator linkdescriptiontitle existing Wikipedia article about the translatorcan suffix with a numeral to add additional translatorstypewikipagenamealiasestranslatorlinktranslatorlinktranslatorlaslabeltranslator last namedescriptionthe surnamethe second translatordont wikilinkusetranslatorlinkaliasestranslatortranslatorlasttype stringtranslatorfirslabeltranslator first namdescriptiongiven or first name middle namesor initials the second translatordon't wikilinkuse translatorlinkaliasestranslatorfirsttypestringtranslatorlast labeltranslator last namdescriptionthe surnamethe third translatordont wikilink use translatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirstlabeltranslator firstname,descriptiongiven or first name,middle namesor initialsthe third translator dont wikilinkusetranslatorlinkaliases translatorfirsttypestringtranslatorastranslator last name descriptionthe surnamethe fourth translatordont wikilinkuse translatorlinkaliasestranslatortranslatorlast
}}
typestringtranslatorfirstlabeltranslatorfirst namedescriptiongiven or first namemiddle namesor initials the fourth translatordon't wikilinkuse translatorlinaliasestranslatorfirsttypestringtranslatorlastlabeltranslator last namedescriptionthe surname the fifth translatordont wikilinkusetranslatorlinkaliasestranslatortranslatorlaststringtranslatorfirslabeltranslator first name descriptiongiven or first namemiddle namesor initials the fifth translatordont wikilink use translatorlinkaliasestranslatorfirsttypestringtranslatorlaslabeltranslator last namedescriptionthe surnamethe sixth translatordon't wikilinkusetranslatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirslabeltranslator first namedescriptiongiven or first name middle namesor initialsthe sixth translatordont wikilinkuse translatorlinkaliasestranslatofirsttypestringtranslatorlastlabeltranslator last namedescriptionthe surnamethe seventh translatordon't wikilinkusetranslatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirslabel translator firstnamedescriptiongiven or first name middle namesor initialsthe seventh translatordont wikilinkusetranslatorlinkaliasestranslatorfirsttypestringtranslatorlalabeltranslatorlast namedescriptionthe surname the eighth translatordont wikilinkusetranslatorlinkaliases
</pre>
translatortranslatorlasttypestringtranslatorfirslabeltranslator first namedescriptiongiven or first name middle namesorinitialsthe eighth translatordont wikilink use translatorlinkaliasestranslatorfirsttypestringtranslatorlaslabeltranslatorlast name descriptionthe surname the ninth translatordon't wikilinkuse translatorlinkaliasestranslatortranslatorlasttypestringtranslatorfirst: labeltranslator first namdescriptiongiven or first name middle names or initials the ninth translatordon't wikilinkusetranslatorlinkaliasestranslatorfirsttypestringtranslatorlinklabeltranslatorlink descriptiontitleexisting Wikipedia articlethe second translator
|}
typewikipagenamealiasestranslatorlinktranslatorlinlabeltranslator linkdescriptiontitleexisting Wikipedia articlethe third translatortypewikipagenamealiasestranslatorlinktranslatorlinlabeltranslatorlinkdescriptiontitleexisting Wikipedia article aboutthe fourth translatortypewikipagename

aliasestranslatorlinktranslatorlinlabektranslator linkdescriptiontitleexistingwikipedia article about the fifth translatortypepagenamealiasestranslatorlinktranslatorlinlabeltranslator linkdescriptiontitleexisting Wikipedia articlethe sixth translatortypewikipagenamealiasestranslatolinktranslatorlinlabeltranslator linkdescriptiontitleexistingarticlethe seventh translatortypepagenamealiasestranslatolinktranslatorlinlabeltranslatorinkdescriptiontitle existing Wikipedia article about the eighth translatortypepagenamealiasestranslatolinklinlabellindescriptiontitle existing Wikipedia article about the ninth translatortypewikipagenamealiases translatorinklayurlaliases layurllabellay urldescriptionurllink to a nontechnical summary or review the sourcetypelinedisplayauthorlabeldisplay authorsdescriptionnumber authors to display beforeet alis used must be less than the number listedtypenumbernameliststylealiases namelistformatlabelbame list styledescriptionsets the style for the listacceptsampandandvanc amp displays an ampersand after the penultimate nameand the same withand and vanc displays in Vancouver formattypestringmapscitoid editioneditiontitletitlecasenametitlenameacttitleurlurllabelpublishercompanypublisherstudiopublishernetworkpublisherdistributorpublisherpublisherpublisherpublicationtitleworkdictionarytitleworkencyclopediatitleworkbooktitleworkdatedatedateenacteddatedateDecideddateaccessdateaccessdateplaceplace issndoidoilanguagelanguagepodcastercontributorothersauthorfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlastfirstlasttranslatortranslatorfirsttranslatorlasttranslatorfirsttranslatorlastranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirst translatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlastranslatorfirsttranslatorlasteditoreditorfirsteditorlasteditofirsteditolasteditofirsteditolasteditofirsteditolastparamorderlastfirsttitledateurlworkvolume
==Parameters==
issuepagepagespublicationdatedfyearpostscripteditorlasteditorfirst
===Syntax===
authormaskorigyeartranstitletranschaptertypearchiveurlseriesat
{{csdoc|syntax|lua=yes}}
noppchaptercontributionchapterurlcontributionurlchaptertotherseditionplacepublicationplacepublisherlanguageformatarxivasinasintldbibcodebiorxivciteseerxdoidoibrokendateisbnissneissnjfmjstorlccnmroclcolostipmcpmidrfc

ssrnzblidquoterefaccessdatelayurlaysourcelaydatenameliststyledisplayauthorsarchivedatelastfirslasfirslasfirstlastfirstlast
{{csdoc|sep_comma|lua=yes}}
firslasfirslasfirslasfirsauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkauthorlinkeditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlasteditorfirsteditorlinkeditorlinkeditorlinkeditorlinkeditorlinktranslatorlasttranslatorfirsttranslatorlinktranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatolasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlasttranslatorfirsttranslatorlinklinktranslatorlinktranslatorlinktranslatorlinktranslatorlinktranslatorlinktranslatorlitemplatedata

cosee alsowikipediacitation templateswikipediainline citationwikipediaparenthetical referencing
===COinS===
foracomparisoncitations using templates withcitations written freehandseewikipediaciting sourcesexample edits for different methodsfootnoteswikipediaciting sourcesexample edits for different methodsnbspdootnotes botesreflist
{{csdoc|coins|lua=yes}}
wikipedia referencingwikipedia help pages

includeonlysandbox other categories go below thislinepleaseinterwikis go to Wikidatathank youcategorycitation styletemplatesincludeonly
===What's new===
{{csdoc|whats new}}

===Deprecated===
{{csdoc|deprecated|lua=yes}}

===Description===
====Authors====
{{csdoc|author|lua=yes||contributor=yes|others=yes}}

====Editors====
{{csdoc|editor|lua=yes}}

====Title====
{{csdoc|title|lua=yes|title_format=italics}}
{{csdoc|chapter|lua=yes}}
{{csdoc|type|lua=yes}}
{{csdoc|language|lua=yes}}

====Date====
{{csdoc|date|lua=yes}}

====Work====
{{csdoc|journal|lua=yes}}

====Publisher====
{{csdoc|publisher|lua=yes}}

====Edition, series, volume====
{{csdoc|edition|lua=yes}}
{{csdoc|series|lua=yes}}
{{csdoc|volume|lua=yes}}

====In-source locations====
{{csdoc|pages|lua=yes}}

====URL====
{{anchor|url}}{{csdoc|url}}

====Chapter URL====
{{anchor|chapterurl}}{{csdoc|chapterurl|lua=yes}}

====Anchor====
{{csdoc|ref|lua=yes}}

====Identifiers====
{{anchor|id1}}{{csdoc|id1|lua=yes}}
{{anchor|id2}}{{csdoc|id2|lua=yes}}

====Quote====
{{csdoc|quote|lua=yes|cs2=yes}}

====Laysummary====
{{csdoc|lay|lua=yes}}

====Display options====
{{csdoc|display|lua=yes|cs2=yes}}

====Subscription or registration required====
{{csdoc|registration|lua=yes}}

==Examples==
===Books===
{| class="wikitable"
|-
| Three authors, a volume, and an edition. Ampersand (&amp;) forced before final author's name.
| <pre>{{Citation
| last1 = Lincoln
| first1 = A.
| last2 = Washington
| first2 = G.
| last3 = Adams
| first3 = J.
| name-list-style = amp
| title = All the Presidents' Names
| publisher = The Pentagon
| place = Home Base, New York
| volume = XII
| edition = 2nd
| year = 2007
}}
</pre>
| {{Citation
| last1 = Lincoln
| first1 = A.
| last2 = Washington
| first2 = G.
| last3 = Adams
| first3 = J.
| name-list-style = amp
| title = All the Presidents' Names
| publisher = The Pentagon
| place = Home Base, New York
| volume = XII
| edition = 2nd
| year = 2007
}}
|}

===Web===
{| class="wikitable"
|-
| Web page
| <pre>{{Citation
| url = http://nrhp.focus.nps.gov/
| title = NPS Focus
| work = National Register of Historic Places
| publisher = [[National Park Service]]
| access-date = November 30, 2010
| ref = none
}}
</pre>
| {{Citation
| url = http://nrhp.focus.nps.gov/
| title = NPS Focus
| work = National Register of Historic Places
| publisher = [[National Park Service]]
| access-date = November 30, 2010
| ref = none
}}
|-
| Archived page
| <pre>{{Citation
| url = http://liftoff.msfc.nasa.gov/academy/space/atmosphere.html
| title = Earth's Atmosphere
| access-date = October 25, 2007
| publisher = [[National Aeronautics and Space Administration]]
| year = 1995
| author = NASA
| archive-url = https://web.archive.org/web/20071013232332/http://
liftoff.msfc.nasa.gov/academy/space/atmosphere.html
| archive-date = October 13, 2007
}}
</pre>
| {{Citation | url = http://liftoff.msfc.nasa.gov/academy/space/atmosphere.html | title = Earth's Atmosphere | access-date = October 25, 2007 | publisher = [[National Aeronautics and Space Administration]] | year = 1995 | author = NASA | archive-url = https://web.archive.org/web/20071013232332/http://liftoff.msfc.nasa.gov/academy/space/atmosphere.html | archive-date = October 13, 2007}}
|}

===Journals, newspapers, magazines, or other periodicals===
{| class="wikitable"
|-
| Journal article
| <pre>{{Citation
| last = Hill
| first = Marvin S.
| title = Joseph Smith and the 1826
Trial: New Evidence and New
Difficulties
| journal = BYU Studies
| volume = 12
| issue = 2
| year = 1976
| pages = 1–8
| url = https://byustudies.byu.edu/shop/PDFSRC/12.2Hill.pdf
}}
</pre>
| {{Citation
| last = Hill
| first = Marvin S.
| title = Joseph Smith and the 1826 Trial: New Evidence and New Difficulties
| journal = BYU Studies
| volume = 12
| issue = 2
| year = 1976
| pages = 1–8
| url = https://byustudies.byu.edu/shop/PDFSRC/12.2Hill.pdf
}}
|-
| Journal article with multiple authors and identifier
| <pre>{{Citation
| last1 = Mandelkern
| first1 = M
| last2 = Elias
| first2 = J
| last3 = Eden
| first3 = D
| last4 = Crothers
| first4 = D
| display-authors = 2
| title = The dimensions of DNA in solution
| journal = J Mol Biol
| volume = 152
| issue = 1
| pages = 153–161
| year = 1981
| pmid = 7338906
| doi = 10.1016/0022-2836(81)90099-1
}}
</pre>
| {{Citation
| last1 = Mandelkern
| first1 = M
| last2 = Elias
| first2 = J
| last3 = Eden
| first3 = D
| last4 = Crothers
| first4 = D
| display-authors = 2
| title = The dimensions of DNA in solution
| journal = J Mol Biol
| volume = 152
| issue = 1
| pages = 153–161
| year = 1981
| pmid = 7338906
| doi = 10.1016/0022-2836(81)90099-1
}}
|-
| Newspaper article
| <pre>{{Citation
| last = Smith
| first = Joseph III
| author-link = Joseph Smith III
| title = Last Testimony of Sister Emma
| newspaper = The Saints' Herald
| location = Plano, IL
| volume = 26
| issue = 19
| date = October 1, 1879
| page = 289
| url = http://www.sidneyrigdon.com/dbroadhu/
IL/sain1872.htm#100179
}}
</pre>
| {{Citation
| last = Smith
| first = Joseph III
| author-link = Joseph Smith III
| title = Last Testimony of Sister Emma
| newspaper = The Saints' Herald
| location = Plano, IL
| volume = 26
| issue = 19
| date = October 1, 1879
| page = 289
| url = http://www.sidneyrigdon.com/dbroadhu/IL/sain1872.htm#100179
}}
|}

===Conference papers and public lectures===
{| class="wikitable"
|-
| Conference paper
| <pre>{{Citation
| last = Sullivan
| first = D.B.
| contribution = Time and frequency measurement
at NIST: The first 100 years
| year = 2001
| title = 2001 IEEE Int'l Frequency Control Symp.
| publisher = National Institute of Standards and Technology
| contribution-url = http://tf.nist.gov/timefreq/general/pdf/1485.pdf
}}
</pre>
| {{Citation
| last = Sullivan
| first = D.B.
| contribution = Time and frequency measurement at NIST: The first 100 years
| year = 2001
| title = 2001 IEEE Int'l Frequency Control Symp.
| publisher = National Institute of Standards and Technology
| contribution-url = http://tf.nist.gov/timefreq/general/pdf/1485.pdf
}}
|-
| Lecture
| <pre>{{Citation
| last = Habicht
| first = Christian
| contribution = Hellenistic Athens and her Philosophers
| year = 1988
| title = David Magie Lecture, Princeton University Program in the History, Archaeology, and Religions of the Ancient World
| publisher = Princeton University
| page=14
}}
</pre>
|{{Citation
| last = Habicht
| first = Christian
| contribution = Hellenistic Athens and her Philosophers
| year = 1988
| title = David Magie Lecture, Princeton University Program in the History, Archaeology, and Religions of the Ancient World
| publisher = Princeton University
| page=14
}}
|}

===Parts of books, including encyclopedia articles===
{| class="wikitable"
|-
|Manuscript published in an edited compilation
|<pre>{{Citation
| last = Bidamon
| first = Emma Smith
| author-link = Emma Hale Smith
| chapter = Letter to Emma S. Pilgrim
| date = March 27, 1876
| editor-last = Vogel
| editor-first = Dan
| title = Early Mormon Documents
| volume = 1
| publisher = Signature Books
| publication-date = 1996
| isbn = 1-56085-072-8
}}
</pre>
| {{Citation
| last = Bidamon
| first = Emma Smith
| author-link = Emma Hale Smith
| chapter = Letter to Emma S. Pilgrim
| date = March 27, 1876
| editor-last = Vogel
| editor-first = Dan
| title = Early Mormon Documents
| volume = 1
| publisher = Signature Books
| publication-date = 1996
| isbn = 1-56085-072-8
}}
|-
| Work with an editor but no author
| <pre>{{Citation
| editor-last = Vogel
| editor-first = Dan
| title = Early Mormon Documents
| volume = 1
| publisher = Signature Books
| date = 1996
| isbn = 1-56085-072-8
}}
</pre>
| {{Citation
| editor-last = Vogel
| editor-first = Dan
| title = Early Mormon Documents
| volume = 1
| publisher = Signature Books
| date = 1996
| isbn = 1-56085-072-8
}}
|-
| Encyclopedia article by a named author
| <pre>{{Citation
| last = Kramer
| first = Martin
| author-link = Martin Kramer
| year=1999
| title = Bernard Lewis
| editor-last = Boyd
| editor-first = Kelley
| encyclopedia = Encyclopedia of Historians and Historical Writing
| volume = 1
| pages = 719–720
| location = London
| publisher = Fitzroy Dearborn
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm
}}
</pre>
| {{Citation
| last = Kramer
| first = Martin
| author-link = Martin Kramer
| year = 1999
| title = Bernard Lewis
| editor-last = Boyd
| editor-first = Kelley
| encyclopedia = Encyclopedia of Historians and Historical Writing
| volume = 1
| pages = 719–720
| location = London
| publisher = Fitzroy Dearborn
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm
}}
|-
| Encyclopedia article with no named author
| <pre>{{Citation
| title = Bernard Lewis
| editor-last = Boyd
| editor-first = Kelley
| year = 1999
| encyclopedia = Encyclopedia of Historians
and Historical Writing
| volume = 1
| pages = 719–720
| publisher = Fitzroy Dearborn
| location = London
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm
}}
</pre>
| {{Citation
| title = Bernard Lewis
| editor-last = Boyd
| editor-first = Kelley
| year = 1999
| encyclopedia = Encyclopedia of Historians and Historical Writing
| volume = 1
| pages = 719–720
| location = London
| publisher = Fitzroy Dearborn
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm
}}
|}

===Republications, or edited quotations in a periodical article===
{| class="wikitable"
|-
| Manuscript edited and published in a journal
| <pre>{{Citation
| last = Knight
| first = Joseph, Sr.
| year = 1833
| editor-last = Jessee
| editor-first = Dean
| title = Joseph Knight's Recollection
of Early Mormon History
| journal = BYU Studies
| volume = 17
| issue = 1
| publication-date = 1976
| page = 35
| url = https://byustudies.byu.edu/shop/PDFSRC/17.1Jessee.pdf
}}</pre>
| {{Citation
| last = Knight
| first = Joseph, Sr.
| year = 1833
| editor-last = Jessee
| editor-first = Dean
| title = Joseph Knight's Recollection of Early Mormon History
| journal = BYU Studies
| volume = 17
| issue = 1
| publication-date = 1976
| page = 35
| url = https://byustudies.byu.edu/shop/PDFSRC/17.1Jessee.pdf
}}
|-
| Manuscript written at one date and place, then published in a periodical at a different date and place with commentary by the editor.
| <pre>{{Citation
| last = Klingensmith
| first = Philip
| type = Affidavit
| date = September 5, 1872
| place = Lincoln County, Nevada
| title = Mountain Meadows Massacre
| editor-last = Toohy
| editor-first = Dennis J.
| journal = Corinne Daily Reporter
| publication-date = September 24, 1872
| publication-place = Corinne, Utah
| volume = 5
| issue = 252
| page = 1
| url = http://udn.lib.utah.edu/u?/corinne,5359
}}
</pre>
| {{Citation
| last = Klingensmith
| first = Philip
| type = Affidavit
| date = September 5, 1872
| place = Lincoln County, Nevada
| title = Mountain Meadows Massacre
| editor-last = Toohy
| editor-first = Dennis J.
| journal = Corinne Daily Reporter
| publication-date = September 24, 1872
| publication-place = Corinne, Utah
| volume = 5
| issue = 252
| page = 1
| url = http://udn.lib.utah.edu/u?/corinne,5359
}}
|}

===Press release===
{| class="wikitable"
|-
| Press release with quotation
| <pre>{{Citation
| url = https://www.apple.com/pr/library/2010/04/05ipad.html
| title = Apple Sells Over 300,000 iPads First Day
| publisher = Apple Inc
| access-date = April 10, 2010
| quote = in the US as of midnight Saturday, April 3
| ref = none}}
</pre>
| {{Citation
| url = https://www.apple.com/pr/library/2010/04/05ipad.html
| title = Apple Sells Over 300,000 iPads First Day
| publisher = Apple Inc
| access-date = April 10, 2010
| quote = in the US as of midnight Saturday, April 3
| ref = none}}
|}

==Anchored citations==
This template can generate a citation that can be combined with [[WP:CITESHORT|shortened footnotes]] or [[Wikipedia:Parenthetical referencing|parenthetical referencing]]. It does this by creating an [[HTML element#Anchor|HTML anchor]] containing an ID. The special parameter {{para|ref|harv}} generates an ID suitable for [[Harvard referencing]] templates such as {{tl|harv}} as specified in the next section; this is the default for the {{tl|citation}} template.

To disable anchor generation, specify {{para|ref|none}}. You can also specify the ID directly, using the {{para|ref|<var>ID</var>}} parameter. For example, suppose an article's ''References'' section contains the markup:
* <code><nowiki>{{Citation |author=Sigmund Freud |title=Civilization and Its Discontents |date=1930 |ref=CivDis}}</nowiki></code>
which generates the citation:
* {{Citation |author=Sigmund Freud |title=Civilization and Its Discontents |date=1930 |ref=CivDis}}
Then, the markup "<code><nowiki>([[#CivDis|Freud 1930]])</nowiki></code>" generates a parenthetical reference "([[#CivDis|Freud 1930]])" containing a wikilink to the citation (try clicking on the wikilink).

===Anchors for Harvard referencing templates===
IDs compatible with Harvard referencing templates such as {{tl|harv}} are computed from the last names of the authors (or editors, if no authors are given) and the year of the cited source. For example, the markup "<code><nowiki>{{harv|Wright|Evans|1851|p=ix}}</nowiki></code>" generates the Harvard reference "{{harv|Wright|Evans|1851|p=ix}}", which wikilinks to the citation whose markup and appearance are shown below:
* <code><nowiki>{{Citation |last1=Wright |first1=Thomas |last2=Evans |first2=R. H. |title=Historical and Descriptive Account of the Caricatures of James Gillray |location=London |publisher=Henry G. Bohn |date=1851 |oclc=59510372}}</nowiki></code>
* {{Citation |last1=Wright |first1=Thomas |last2=Evans |first2=R. H. |title=Historical and Descriptive Account of the Caricatures of James Gillray |location=London |publisher=Henry G. Bohn |date=1851 |oclc=59510372}}
In this example the {{tl|citation}} template defines, and the {{tl|harv}} template uses, the HTML ID "<code>CITEREFWrightEvans1851</code>", composed by concatenating the string "<code>CITEREF</code>" with the last names of the authors and the year. The {{tl|harvid}} template can be used to generate such IDs, for example, <code><nowiki>{{harvid|Wright|Evans|1851}}</nowiki></code> generates "<code>{{harvid|Wright|Evans|1851}}</code>".

Related methods which leave only a number in the text are to use the {{tl|harvnb}} template enclosed in the <nowiki><ref></ref></nowiki> html code, or to use the {{tl|sfn}} template alone. The example above would be <code><nowiki><ref>{{harvnb|Wright|Evans|1851|p=ix}}</ref></nowiki></code> or <code><nowiki>{{sfn|Wright|Evans|1851|p=ix}}</nowiki></code> both of which generate a footnote, such as
:17. {{harvnb|Wright|Evans|1851|p=ix}}

The names of only the first four authors are used; other author names are not concatenated to the ID. If no author names are given, editor names are used instead.

Last names are used, as specified by the parameters {{para|last1}} (or {{para|last}}), {{para|last2}}, {{para|last3}}, and {{para|last4}}, and similarly for {{para|editor1-last}} etc. and for {{para|inventor1-last}} etc. If a full name is given but no last name is specified, this template falls back on the full name, but this usage is not recommended. For example, in "<code><nowiki>{{Citation |author=Sigmund Freud |title=The Ego and the Id |date=1923}}</nowiki></code>" no last name is given, so this citation cannot be combined with the Harvard reference "<code><nowiki>{{harv|Freud|1923}}</nowiki></code>". To make these {{tl|citation}} and {{tl|harv}} invocations compatible, either replace "{{para|author|Sigmund Freud}}" with "{{para|first|Sigmund}} {{para|last|Freud}}", or add "{{para|ref|<nowiki>{{harvid|Freud|1923}}</nowiki>}}" to the {{tl|citation}} invocation, or add the same ref parameter (say, "{{para|ref|EgoId}}") to both the {{tl|citation}} and the {{tl|harv}} invocations.

<!-- This paragraph appears to be outdated and probably needs to be updated to reflect current CS1/CS2 functionality: -->Similarly, the year is used, as specified by {{para|year}}. If no year is given, this template attempts to derive the year from {{para|date}} (or, if no date is given, from {{para|publication-date}}) by applying the [[mw:Help:Extension:ParserFunctions##time|MediaWiki §&nbsp;Time function]]. This heuristic works with most common date formats (American, International and [[ISO 8601#Calendar dates|ISO 8601 standard format]] YYYY-MM-DD as listed in [[WP:MOS]]), but may not work as expected with other formats, so when in doubt it may be safer to use {{para|year}}.

===IDs must be unique===
Names, years, and hand-specified IDs must be chosen so that the IDs are unique within a page; otherwise the HTML will not conform to the W3C standards, and any references to the citations will not work reliably. For example, suppose a page contains the following two citations with {{tl|harv}}-compatible IDs:
* {{Citation |last1=Montes |first1=G. |last2=Halterman |first2=J. S. |date=2008a |journal=Pediatrics |volume=121 |issue=4 |pages=e821–e826 |title=Association of Childhood Autism Spectrum Disorders and Loss of Family Income |doi=10.1542/peds.2007-1594 |pmid=18381511 |url=http://pediatrics.aappublications.org/cgi/content/full/121/4/e821}}
* {{Citation |last1=Montes |first1=G. |last2=Halterman |first2=J. S. |date=2008b |journal=Pediatrics |volume=122 |issue=1 |pages=e202–e208 |title=Child Care Problems and Employment Among Families with Preschool-aged Children with Autism in the United States |doi=10.1542/peds.2007-3037 |pmid=18595965 |url=http://pediatrics.aappublications.org/cgi/content/full/122/1/e202}}

If these citations were altered to say "2008" rather than "2008a" and "2008b", the resulting page would not work, because the two different citations would both attempt to use the ID "<code>CITEREFMontesHalterman2008</code>". To avoid this problem, distinguish the citations by appending suffixes to the years, e.g. "{{para|date|2008a}}" and "{{para|date|2008b}}", as was done above. Any Harvard references to these citations should use years with the same suffixes.

It is good practice to verify that a page does not contain duplicate IDs by using the [[W3C Markup Validation Service]]; see ''[[#External links|External links]]''.

==Dates==
{{Reflist|group="n"|refs=<ref name="dates" group="n">The format of dates in the references of an article should use consistent and unambiguous styles. Example formats used in Wikipedia citations include:
* ''2009''
* ''2009-09-14'' ([[ISO 8601#Calendar dates|ISO 8601 standard format]]: YYYY-MM-DD)
* ''14 September 2009''
* ''September 14, 2009'' (with comma)
* ''September 2009''

Dates should not be linked (say, to a Wikipedia article of the same name) in references.

Please see [[Wikipedia:Manual of Style (dates and numbers)#Dates|Wikipedia:Manual of Style (dates and numbers) §&nbsp;Dates]] for more guidance about formatting dates.
</ref>}}

==Tools==
See [[Wikipedia:Citing sources#Citation templates and tools|Wikipedia:Citing sources §&nbsp;Citation templates and tools]] for a list of tools that can help create a reference in the "citation" format.

==TemplateData==
{{notice|This template data section needs to be edited. It includes deprecated parameters and does not include parameters that were added in the Lua updates.}}

{{TemplateData header}}
<templatedata>
{
"description": "The Citation template generates a citation for a book, periodical, contribution in a collective work, or a web page. It determines the citation type by examining which parameters are used.",
"params": {
"last": {
"label": "Last name",
"description": "The surname of the author; don't wikilink, use 'author-link' instead; can suffix with a numeral to add additional authors",
"aliases": [
"author",
"author1",
"last1"
],
"type": "line",
"suggested": true
},
"first": {
"label": "First name",
"description": "Given or first name, middle names, or initials of the author; don't wikilink, use 'author-link' instead; can suffix with a numeral to add additional authors",
"aliases": [
"first1"
],
"type": "line",
"suggested": true
},
"title": {
"label": "Title of source",
"type": "string",
"description": "Title of source. Works display in italics and articles surrounded in quotation marks.",
"required": true
},
"date": {
"label": "Date of source",
"type": "string",
"description": "Full date of source being referenced in the same format as other publication dates in the citations.[1] Do not wikilink. Displays after the authors and enclosed in parentheses. If there is no author, then displays after publisher."
},
"url": {
"label": "URL of source",
"type": "string",
"description": "URL of an online location where the text of the publication can be found."
},
"publication-date": {
"label": "Publication date",
"type": "string",
"required": false,
"description": "Date of publication when different from the date the work was written. Displays only if year or date are defined and only if different, else publication-date is used and displayed as date. Use the same format as other dates in the article; do not wikilink. Follows publisher; if work is not defined, then publication-date is preceded by \"published\" and enclosed in parenthesis."
},
"df": {
"label": "Date format",
"description": "Sets rendered dates to the specified format",
"type": "string"
},
"year": {
"label": "Year of publication",
"description": "Year of the source being referenced; recommended only when date parameter format is YYYY-MM-DD and a CITEREF disambiguator is needed",
"type": "number"
},
"postscript": {
"label": "Postscript",
"type": "string",
"required": false,
"description": "Controls the closing punctuation for a citation; defaults to a period (.); for no terminating punctuation, specify |postscript=none – leaving |postscript= empty is the same as omitting it, but is ambiguous. Ignored if quote is defined."
},
"author-mask": {
"label": "Author mask",
"type": "string",
"required": false,
"aliases": [
"authormask"
],
"description": "Replaces the name of the first author with em dashes or text. Set author-mask to a numeric value n to set the dash n em spaces wide; set author-mask to a text value to display the text without a trailing author separator; for example, \"with\". You must still include the values for all authors for metadata purposes. Primarily intended for use with bibliographies or bibliography styles where multiple works by a single author are listed sequentially such as shortened footnotes. Do not use in a list generated by {{reflist}}, <references /> or similar as there is no control of the order in which references are displayed. You can also use editor-mask and translator-mask in the same way."
},
"last2": {
"label": "Last name 2",
"description": "The surname of the second author; don't wikilink, use 'author-link2' instead.",
"aliases": [
"author2",
"surname2"
],
"type": "line"
},
"first2": {
"label": "First name 2",
"description": "Given or first name, middle names, or initials of the second author; don't wikilink.",
"type": "line",
"aliases": [
"given2"
]
},
"last3": {
"label": "Last name 3",
"description": "The surname of the third author; don't wikilink, use 'author-link3' instead.",
"aliases": [
"author3",
"surname3"
],
"type": "line"
},
"first3": {
"label": "First name 3",
"description": "Given or first name, middle names, or initials of the third author; don't wikilink.",
"type": "line",
"aliases": [
"given3"
]
},
"last4": {
"label": "Last name 4",
"description": "The surname of the forth author; don't wikilink, use 'author-link4' instead.",
"aliases": [
"author4",
"surname4"
],
"type": "line"
},
"first4": {
"label": "First name 4",
"description": "Given or first name, middle names, or initials of the forth author; don't wikilink.",
"type": "line",
"aliases": [
"given4"
]
},
"last5": {
"label": "Last name 5",
"description": "The surname of the fifth author; don't wikilink, use 'author-link5' instead.",
"aliases": [
"author5",
"surname5"
],
"type": "line"
},
"first5": {
"label": "First name 5",
"description": "Given or first name, middle names, or initials of the fifth author; don't wikilink.",
"type": "line",
"aliases": [
"given5"
]
},
"last6": {
"label": "Last name 6",
"description": "The surname of the sixth author; don't wikilink, use 'author-link6' instead.",
"aliases": [
"author6",
"surname6"
],
"type": "line"
},
"first6": {
"label": "First name 6",
"description": "Given or first name, middle names, or initials of the sixth author; don't wikilink.",
"type": "line"
},
"last7": {
"label": "Last name 7",
"description": "The surname of the seventh author; don't wikilink, use 'author-link7' instead.",
"aliases": [
"author7",
"surname7"
],
"type": "line"
},
"first7": {
"label": "First name 7",
"description": "Given or first name, middle names, or initials of the seventh author; don't wikilink.",
"type": "line",
"aliases": [
"given7"
]
},
"last8": {
"label": "Last name 8",
"description": "The surname of the eighth author; don't wikilink, use 'author-link8' instead.",
"aliases": [
"author8",
"surname8"
],
"type": "line"
},
"first8": {
"label": "First name 8",
"description": "Given or first name, middle names, or initials of the eighth author; don't wikilink.",
"type": "line",
"aliases": [
"given8"
]
},
"last9": {
"label": "Last name 9",
"description": "The surname of the ninth author; don't wikilink, use 'author-link9' instead. If nine authors are defined, then only eight will show and 'et al.' will show in place of the last author.",
"aliases": [
"author9",
"surname9"
],
"type": "line"
},
"first9": {
"label": "First name 9",
"description": "Given or first name, middle names, or initials of the ninth author; don't wikilink.",
"type": "line",
"aliases": [
"given9"
]
},
"author-link": {
"label": "Author link",
"description": "Title of existing Wikipedia article about the author; can suffix with a numeral to add additional authors",
"type": "wiki-page-name",
"aliases": [
"authorlink",
"author1-link",
"authorlink1"
]
},
"author-link2": {
"label": "Author link 2",
"description": "Title of existing Wikipedia article about the second author.",
"type": "wiki-page-name",
"aliases": [
"author2-link",
"authorlink2"
]
},
"author-link3": {
"label": "Author link 3",
"description": "Title of existing Wikipedia article about the third author.",
"type": "wiki-page-name",
"aliases": [
"author3-link",
"authorlink3"
]
},
"author-link4": {
"label": "Author link 4",
"description": "Title of existing Wikipedia article about the forth author.",
"type": "wiki-page-name",
"aliases": [
"author4-link",
"authorlink4"
]
},
"author-link5": {
"label": "Author link 5",
"description": "Title of existing Wikipedia article about the sixth author.",
"type": "wiki-page-name",
"aliases": [
"author5-link",
"authorlink5"
]
},
"author-link6": {
"label": "Author link 6",
"description": "Title of existing Wikipedia article about the sixth author.",
"type": "wiki-page-name",
"aliases": [
"author6-link",
"authorlink6"
]
},
"author-link7": {
"label": "Author link 7",
"description": "Title of existing Wikipedia article about the seventh author.",
"type": "wiki-page-name",
"aliases": [
"author7-link",
"authorlink7"
]
},
"author-link8": {
"label": "Author link 8",
"description": "Title of existing Wikipedia article about the eighth author.",
"type": "wiki-page-name",
"aliases": [
"author8-link",
"authorlink8"
]
},
"author-link9": {
"label": "Author link 9",
"description": "Title of existing Wikipedia article about the ninth author.",
"type": "wiki-page-name",
"aliases": [
"author9-link",
"authorlink9"
]
},
"orig-year": {
"label": "Original year",
"description": "Original year of publication; provide specifics",
"type": "number",
"aliases": [
"origyear"
]
},
"trans-title": {
"label": "Translated title",
"description": "An English language title, if the source cited is in a foreign language; 'language' is recommended",
"type": "content"
},
"trans-chapter": {
"label": "Translated chapter title",
"description": "An English language chapter title, if the source cited is in a foreign language; 'language' is recommended",
"type": "content"
},
"type": {
"label": "Type",
"description": "Additional information about the media type of the source; format in sentence case",
"type": "content"
},
"archive-url": {
"label": "Archive URL",
"description": "The URL of an archived copy of a web page, if or in case the URL becomes unavailable; requires 'archive-date'",
"type": "line",
"aliases": [
"archiveurl"
]
},
"series": {
"label": "Series",
"description": "Series identifier when the source is part of a series, such as a book series or a journal; alias of 'version'",
"type": "content",
"aliases": [
"version"
]
},
"work": {
"label": "Work",
"description": "Name of the work in which the cited title is found",
"type": "string",
"aliases": [
"journal",
"website",
"newspaper",
"magazine",
"encyclopedia",
"encyclopaedia",
"dictionary",
"mailinglist",
"periodical"
]
},
"volume": {
"label": "Volume",
"description": "For one publication published in several volumes",
"type": "line",
"suggested": true
},
"issue": {
"label": "Issue",
"description": "Issue number",
"type": "string",
"aliases": [
"number"
]
},
"page": {
"label": "Page",
"description": "Page in the source that supports the content; displays after 'p.'",
"type": "line"
},
"pages": {
"label": "Pages",
"description": "Pages in the source that support the content (not an indication of the number of pages in the source; displays after 'pp.'",
"type": "line",
"suggested": true
},
"at": {
"label": "At",
"description": "May be used instead of 'page' or 'pages' where a page number is inappropriate or insufficient",
"type": "line"
},
"nopp": {
"label": "No pp",
"description": "Set to 'y' to suppress the 'p.' or 'pp.' display with 'page' or 'pages' when inappropriate (such as 'Front cover')",
"type": "line"
},
"chapter": {
"label": "Chapter",
"description": "The chapter heading of the source",
"type": "string"
},
"contribution": {
"label": "contribution",
"type": "string",
"required": false
},
"chapter-url": {
"label": "chapter-url",
"type": "string",
"required": false,
"aliases": [
"chapterurl"
]
},
"contribution-url": {
"label": "contribution-url",
"type": "string",
"required": false
},
"chapter-format": {
"label": "chapter-format",
"type": "string",
"required": false
},
"others": {
"label": "Others",
"type": "string",
"required": false,
"description": "Free-text field for people involved in creating a work who cannot be added with another name parameter such as author or editor"
},
"edition": {
"label": "Edition",
"description": "When the publication has more than one edition; for example: '2nd', 'Revised' etc.; suffixed with ' ed.'",
"type": "line"
},
"place": {
"label": "Location of publication",
"description": "Geographical place of publication; usually not wikilinked",
"type": "string",
"aliases": [
"location"
]
},
"publication-place": {
"label": "Place of publication",
"description": "Publication place shows after title; if 'place' or 'location' are also given, they are displayed before the title prefixed with 'written at'",
"type": "content"
},
"publisher": {
"label": "Publisher",
"description": "Name of the publisher; displays after title",
"type": "content"
},
"language": {
"label": "Language",
"description": "The language in which the source is written, if not English; use the full language name; do not use icons or templates",
"type": "content"
},
"format": {
"label": "Format",
"description": "Format of the work referred to by 'url' ('url' is required when using 'format'); examples: PDF, DOC, XLS; do not specify HTML",
"type": "content"
},
"arxiv": {
"label": "arXiv identifier",
"description": "An identifier for arXive electronic preprints of scientific papers",
"type": "line"
},
"asin": {
"label": "ASIN",
"description": "Amazon Standard Identification Number; 10 characters",
"type": "line",
"aliases": [
"ASIN"
]
},
"asin-tld": {
"label": "ASIN TLD",
"description": "ASIN top-level domain for Amazon sites other than the US",
"type": "line"
},
"bibcode": {
"label": "Bibcode",
"description": "Bibliographic Reference Code (REFCODE); 19 characters",
"type": "line"
},
"biorxiv": {
"label": "biorXiv",
"description": "biorXiv identifier; 6 digits",
"type": "line"
},
"citeseerx": {
"label": "CiteSeerX",
"description": "CiteSeerX identifier; found after the 'doi=' query parameter",
"type": "line"
},
"doi": {
"label": "DOI",
"description": "Digital Object Identifier; begins with '10.'",
"type": "string",
"aliases": [
"DOI"
]
},
"doi-broken-date": {
"label": "DOI broken date",
"description": "The date that the DOI was determined to be broken",
"type": "date"
},
"isbn": {
"label": "ISBN",
"description": "International Standard Book Number; use the 13-digit ISBN where possible",
"type": "line"
},
"issn": {
"label": "ISSN",
"description": "International Standard Serial Number (print); 8 characters; usually split into two groups of four using a hyphen",
"type": "line"
},
"eissn": {
"label": "eISSN",
"description": "International Standard Serial Number (online); 8 characters; usually split into two groups of four using a hyphen",
"type": "line"
},
"jfm": {
"label": "jfm code",
"description": "Jahrbuch über die Fortschritte der Mathematik classification code",
"type": "line"
},
"jstor": {
"label": "JSTOR",
"description": "JSTOR identifier",
"type": "line"
},
"lccn": {
"label": "LCCN",
"description": "Library of Congress Control Number",
"type": "line"
},
"mr": {
"label": "MR",
"description": "Mathematical Reviews identifier",
"type": "line"
},
"oclc": {
"label": "OCLC",
"description": "Online Computer Library Center number",
"type": "number"
},
"ol": {
"label": "OL",
"description": "Open Library identifier",
"type": "line"
},
"osti": {
"label": "OSTI",
"description": "Office of Scientific and Technical Information identifier",
"type": "line"
},
"pmc": {
"label": "PMC",
"description": "PubMed Center article number",
"type": "number"
},
"pmid": {
"label": "PMID",
"description": "PubMed Unique Identifier",
"type": "line"
},
"rfc": {
"label": "RFC",
"description": "Request for Comments number",
"type": "number"
},
"ssrn": {
"label": "SSRN",
"description": "Social Science Research Network",
"type": "line"
},
"zbl": {
"label": "Zbl",
"description": "Zentralblatt MATH journal identifier",
"type": "line"
},
"id": {
"label": "id",
"description": "A unique identifier used where none of the specialized ones are applicable",
"type": "line"
},
"quote": {
"label": "Quote",
"description": "Relevant text quoted from the source; displays last, enclosed in quotes; needs to include terminating punctuation",
"type": "content"
},
"ref": {
"label": "Ref",
"description": "An anchor identifier; can be made the target of wikilinks to full references; special value 'harv' generates an anchor suitable for the harv and sfn templates",
"type": "line"
},
"access-date": {
"label": "URL access date",
"description": "The full date when the original URL was accessed; do not wikilink",
"type": "date",
"aliases": [
"accessdate"
]
},
"lay-source": {
"label": "Lay source",
"description": "Name of the source of the laysummary; displays in italics, preceded by an en dash",
"type": "string",
"aliases": [
"laysource"
]
},
"lay-date": {
"label": "Lay date",
"description": "Date of the summary; displays in parentheses",
"type": "date",
"aliases": [
"laydate"
]
},
"archive-date": {
"label": "Archive date",
"description": "Date when the original URL was archived; do not wikilink",
"type": "date",
"aliases": [
"archivedate"
]
},
"editor-last": {
"label": "Editor last name",
"description": "The surname of the editor; don't wikilink, use 'editor-link'; can suffix with a numeral to add additional editors",
"aliases": [
"editor",
"editor-surname",
"editor-last1",
"editor-surname1",
"editor1",
"editor1-last",
"editor1-surname",
"editors"
]
},
"editor-first": {
"label": "Editor first name",
"description": "The surname of the editor; don't wikilink, use 'editor-link'; can suffix with a numeral to add additional editors",
"aliases": [
"editor-first1",
"editor-given1",
"editor1-first",
"editor1-given"
]
},
"editor2-last": {
"label": "Editor last name 2",
"description": "The surname of the second editor; don't wikilink, use 'editor2-link'.",
"aliases": [
"editor2"
],
"type": "line"
},
"editor2-first": {
"label": "Editor first name 2",
"description": "Given or first name, middle names, or initials of the second editor; don't wikilink.",
"type": "line",
"aliases": [
"editor2-given"
]
},
"editor3-last": {
"label": "Editor last name 3",
"description": "The surname of the third editor; don't wikilink, use 'editor3-link'.",
"aliases": [
"editor3"
],
"type": "line"
},
"editor3-first": {
"label": "Editor first name 3",
"description": "Given or first name, middle names, or initials of the third editor; don't wikilink.",
"type": "line",
"aliases": [
"editor3-given"
]
},
"editor4-last": {
"label": "Editor last name 4",
"description": "The surname of the fourth editor; don't wikilink, use 'editor4-link'.",
"aliases": [
"editor4"
],
"type": "line"
},
"editor4-first": {
"label": "Editor first name 4",
"description": "Given or first name, middle names, or initials of the fourth editor; don't wikilink.",
"type": "line",
"aliases": [
"editor4-given"
]
},
"editor5-last": {
"label": "Editor last name 5",
"description": "The surname of the fifth editor; don't wikilink, use 'editor5-link'.",
"aliases": [
"editor5"
],
"type": "line"
},
"editor5-first": {
"label": "Editor first name 5",
"description": "Given or first name, middle names, or initials of the fifth editor; don't wikilink.",
"type": "line",
"aliases": [
"editor5-given"
]
},
"editor6-last": {
"label": "Editor last name 6",
"description": "The surname of the sixth editor; don't wikilink, use 'editor6-link'.",
"aliases": [
"editor6"
],
"type": "line"
},
"editor6-first": {
"label": "Editor first name 6",
"description": "Given or first name, middle names, or initials of the sixth editor; don't wikilink.",
"type": "line",
"aliases": [
"editor6-given"
]
},
"editor7-last": {
"label": "Editor last name 7",
"description": "The surname of the seventh editor; don't wikilink, use 'editor7-link'.",
"aliases": [
"editor7"
],
"type": "line"
},
"editor7-first": {
"label": "Editor first name 7",
"description": "Given or first name, middle names, or initials of the seventh editor; don't wikilink.",
"type": "line",
"aliases": [
"editor7-given"
]
},
"editor8-last": {
"label": "Editor last name 8",
"description": "The surname of the eighth editor; don't wikilink, use 'editor8-link'.",
"aliases": [
"editor8"
],
"type": "line"
},
"editor8-first": {
"label": "Editor first name 8",
"description": "Given or first name, middle names, or initials of the eighth editor; don't wikilink.",
"type": "line",
"aliases": [
"editor8-given"
]
},
"editor9-last": {
"label": "Editor last name 9",
"description": "The surname of the ninth editor; don't wikilink, use 'editor9-link'.",
"aliases": [
"editor9"
],
"type": "line"
},
"editor9-first": {
"label": "Editor first name 9",
"description": "Given or first name, middle names, or initials of the ninth editor; don't wikilink.",
"type": "line",
"aliases": [
"editor9-given"
]
},
"editor-link": {
"label": "editor-link",
"type": "string",
"required": false
},
"editor1-link": {
"label": "editor1-link",
"type": "string",
"required": false
},
"editor2-link": {
"label": "editor2-link",
"type": "string",
"required": false
},
"editor3-link": {
"label": "editor3-link",
"type": "string",
"required": false
},
"editor4-link": {
"label": "editor4-link",
"type": "string",
"required": false
},
"translator-last": {
"label": "Translator last name",
"description": "The surname of the translator; don't wikilink, use 'translator-link'; can suffix with a numeral to add additional translators.",
"aliases": [
"translator",
"translator-last1",
"translator1",
"translator1-last"
],
"type": "string"
},
"translator-first": {
"label": "Translator first name",
"description": "Given or first name, middle names, or initials of the translator; don't wikilink, use 'translator-link'; can suffix with a numeral to add additional translators.",
"aliases": [
"translator1-first",
"translator-first1"
],
"type": "string"
},
"translator-link": {
"label": "Translator link",
"description": "Title of existing Wikipedia article about the translator; can suffix with a numeral to add additional translators.",
"type": "wiki-page-name",
"aliases": [
"translator-link1",
"translator1-link"
]
},
"translator-last2": {
"label": "Translator last name 2",
"description": "The surname of the second translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator2",
"translator2-last"
],
"type": "string"
},
"translator-first2": {
"label": "Translator first name 2",
"description": "Given or first name, middle names, or initials of the second translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator2-first"
],
"type": "string"
},
"translator-last3": {
"label": "Translator last name 3",
"description": "The surname of the third translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator3",
"translator3-last"
],
"type": "string"
},
"translator-first3": {
"label": "Translator first name 3",
"description": "Given or first name, middle names, or initials of the third translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator3-first"
],
"type": "string"
},
"translator-last4": {
"label": "Translator last name 4",
"description": "The surname of the fourth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator4",
"translator4-last"
],
"type": "string"
},
"translator-first4": {
"label": "Translator first name 4",
"description": "Given or first name, middle names, or initials of the fourth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator4-first"
],
"type": "string"
},
"translator-last5": {
"label": "Translator last name 5",
"description": "The surname of the fifth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator5",
"translator5-last"
],
"type": "string"
},
"translator-first5": {
"label": "Translator first name 5",
"description": "Given or first name, middle names, or initials of the fifth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator5-first"
],
"type": "string"
},
"translator-last6": {
"label": "Translator last name 6",
"description": "The surname of the sixth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator6",
"translator6-last"
],
"type": "string"
},
"translator-first6": {
"label": "Translator first name 6",
"description": "Given or first name, middle names, or initials of the sixth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator6-first"
],
"type": "string"
},
"translator-last7": {
"label": "Translator last name 7",
"description": "The surname of the seventh translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator7",
"translator7-last"
],
"type": "string"
},
"translator-first7": {
"label": "Translator first name 7",
"description": "Given or first name, middle names, or initials of the seventh translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator7-first"
],
"type": "string"
},
"translator-last8": {
"label": "Translator last name 8",
"description": "The surname of the eighth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator8",
"translator8-last"
],
"type": "string"
},
"translator-first8": {
"label": "Translator first name 8",
"description": "Given or first name, middle names, or initials of the eighth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator8-first"
],
"type": "string"
},
"translator-last9": {
"label": "Translator last name 9",
"description": "The surname of the ninth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator9",
"translator9-last"
],
"type": "string"
},
"translator-first9": {
"label": "Translator first name 9",
"description": "Given or first name, middle names, or initials of the ninth translator; don't wikilink, use 'translator-link'.",
"aliases": [
"translator9-first"
],
"type": "string"
},
"translator-link2": {
"label": "Translator link 2",
"description": "Title of existing Wikipedia article about the second translator.",
"type": "wiki-page-name",
"aliases": [
"translator2-link"
]
},
"translator-link3": {
"label": "Translator link 3",
"description": "Title of existing Wikipedia article about the third translator.",
"type": "wiki-page-name",
"aliases": [
"translator3-link"
]
},
"translator-link4": {
"label": "Translator link 4",
"description": "Title of existing Wikipedia article about the fourth translator.",
"type": "wiki-page-name",
"aliases": [
"translator4-link"
]
},
"translator-link5": {
"label": "Translator link 5",
"description": "Title of existing Wikipedia article about the fifth translator.",
"type": "wiki-page-name",
"aliases": [
"translator5-link"
]
},
"translator-link6": {
"label": "Translator link 6",
"description": "Title of existing Wikipedia article about the sixth translator.",
"type": "wiki-page-name",
"aliases": [
"translator6-link"
]
},
"translator-link7": {
"label": "Translator link 7",
"description": "Title of existing Wikipedia article about the seventh translator.",
"type": "wiki-page-name",
"aliases": [
"translator7-link"
]
},
"translator-link8": {
"label": "Translator link 8",
"description": "Title of existing Wikipedia article about the eighth translator.",
"type": "wiki-page-name",
"aliases": [
"translator8-link"
]
},
"translator-link9": {
"label": "Translator link 9",
"description": "Title of existing Wikipedia article about the ninth translator.",
"type": "wiki-page-name",
"aliases": [
"translator9-link"
]
},
"lay-url": {
"aliases": [
"layurl"
],
"label": "Lay URL",
"description": "URL link to a non-technical summary or review of the source",
"type": "line"
},
"display-authors": {
"label": "Display authors",
"description": "number of authors to display before 'et al.' is used; must be less than the number listed",
"type": "number"
},
"name-list-style": {
"aliases": [
"name-list-format"
],
"label": "Name list style",
"description": "Sets the style for the list. Accepts 'amp', 'and', and 'vanc'. amp displays an ampersand after the penultimate name; and the same with 'and', and vanc displays in Vancouver format",
"type": "string"
}
},
"maps": {
"citoid": {
"edition": "edition",
"title": "title",
"caseName": "title",
"nameOfAct": "title",
"url": "url",
"label": "publisher",
"company": "publisher",
"studio": "publisher",
"network": "publisher",
"distributor": "publisher",
"publisher": "publisher",
"publicationTitle": "work",
"dictionaryTitle": "work",
"encyclopediaTitle": "work",
"bookTitle": "work",
"date": "date",
"dateEnacted": "date",
"dateDecided": "date",
"accessDate": "access-date",
"place": "place",
"ISSN": [
"issn"
],
"ISBN": [
"isbn"
],
"PMCID": "pmc",
"PMID": "pmid",
"oclc": "oclc",
"pages": "pages",
"firstPage": "pages",
"codePages": "pages",
"volume": "volume",
"reporterVolume": "volume",
"codeVolume": "volume",
"series": "series",
"programTitle": "series",
"episodeNumber": "issue",
"billNumber": "issue",
"documentNumber": "issue",
"publicLawNumber": "issue",
"docketNumber": "issue",
"issue": "issue",
"type": "type",
"genre": "type",
"letterType": "type",
"mapType": "type",
"DOI": "doi",
"language": "language",
"podcaster": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"cartographer": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"interviewee": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"performer": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"programmer": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"sponsor": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"artist": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"director": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"contributor": "others",
"author": [
[
"first",
"last"
],
[
"first2",
"last2"
],
[
"first3",
"last3"
],
[
"first4",
"last4"
],
[
"first5",
"last5"
],
[
"first6",
"last6"
],
[
"first7",
"last7"
],
[
"first8",
"last8"
],
[
"first9",
"last9"
]
],
"translator": [
[
"translator-first",
"translator-last"
],
[
"translator-first2",
"translator-last2"
],
[
"translator-first3",
"translator-last3"
],
[
"translator-first4",
"translator-last4"
],
[
"translator-first5",
"translator-last5"
],
[
"translator-first6",
"translator-last6"
],
[
"translator-first7",
"translator-last7"
],
[
"translator-first8",
"translator-last8"
],
[
"translator-first9",
"translator-last9"
]
],
"editor": [
[
"editor-first",
"editor-last"
],
[
"editor2-first",
"editor2-last"
],
[
"editor3-first",
"editor3-last"
],
[
"editor4-first",
"editor4-last"
]
]
}
},
"paramOrder": [
"last",
"first",
"title",
"date",
"url",
"work",
"volume",
"issue",
"page",
"pages",
"publication-date",
"df",
"year",
"postscript",
"editor-last",
"editor-first",
"author-mask",
"orig-year",
"trans-title",
"trans-chapter",
"type",
"archive-url",
"series",
"at",
"nopp",
"chapter",
"contribution",
"chapter-url",
"contribution-url",
"chapter-format",
"others",
"edition",
"place",
"publication-place",
"publisher",
"language",
"format",
"arxiv",
"asin",
"asin-tld",
"bibcode",
"biorxiv",
"citeseerx",
"doi",
"doi-broken-date",
"isbn",
"issn",
"eissn",
"jfm",
"jstor",
"lccn",
"mr",
"oclc",
"ol",
"osti",
"pmc",
"pmid",
"rfc",
"ssrn",
"zbl",
"id",
"quote",
"ref",
"access-date",
"lay-url",
"lay-source",
"lay-date",
"name-list-style",
"display-authors",
"archive-date",
"last2",
"first2",
"last3",
"first3",
"last4",
"first4",
"last5",
"first5",
"last6",
"first6",
"last7",
"first7",
"last8",
"first8",
"last9",
"first9",
"author-link",
"author-link2",
"author-link3",
"author-link4",
"author-link5",
"author-link6",
"author-link7",
"author-link8",
"author-link9",
"editor2-last",
"editor2-first",
"editor3-last",
"editor3-first",
"editor4-last",
"editor4-first",
"editor5-last",
"editor5-first",
"editor6-last",
"editor6-first",
"editor7-last",
"editor7-first",
"editor8-last",
"editor8-first",
"editor9-last",
"editor9-first",
"editor-link",
"editor1-link",
"editor2-link",
"editor3-link",
"editor4-link",
"translator-last",
"translator-first",
"translator-link",
"translator-last2",
"translator-first2",
"translator-last3",
"translator-first3",
"translator-last4",
"translator-first4",
"translator-last5",
"translator-first5",
"translator-last6",
"translator-first6",
"translator-last7",
"translator-first7",
"translator-last8",
"translator-first8",
"translator-last9",
"translator-first9",
"translator-link2",
"translator-link3",
"translator-link4",
"translator-link5",
"translator-link6",
"translator-link7",
"translator-link8",
"translator-link9"
]
}
</templatedata>

{{UF-COinS}}

== See also ==
* [[Wikipedia:Citation templates]]
* [[Wikipedia:Inline citation]]
* [[Wikipedia:Parenthetical referencing]]
* For a comparison of citations using templates with citations written freehand, see [[Wikipedia:Citing sources/Example edits for different methods#Footnotes|Wikipedia:Citing sources/Example edits for different methods §&nbsp;Footnotes]]

== Notes ==
{{Reflist}}

{{Wikipedia referencing}}
{{Wikipedia help pages}}

<includeonly>{{Sandbox other||
<!-- Categories go below this line, please; interwikis go to Wikidata, thank you! -->
[[Category:Citation Style 2 templates]]
}}</includeonly>

Revision as of 16:38, 30 November 2020

Template:For2


The Citation template generates a citation for a book, periodical, contribution in a collective work, or a web page. It determines the citation type by examining which parameters are used. As with other citation templates, this template can be used either in a footnote (between <ref>...</ref> tags) or in a section that lists sources. This template uses the same Lua code as citation style 1 (CS1) templates with parameters to change the displayed format to citation style 2 (CS2).

If the correct parameters are used, this template produces output identical to that of the Cite templates, such as {{Cite book}} and {{Cite web}}, with one important exception: By default, this Citation template uses commas in places where the Cite templates use periods (full stops) by default; either type of template can use periods (full stops) or commas by using an optional parameter.

Regardless of which citation templates are used or even if none are used at all, all citations should have the same format throughout an article in the saved, rendered text.

Note: All parameter names must be lowercase.

Simple citations

This section covers the most commonly used parameters. You can copy the horizontal form or vertical form below and then add in extra parameters from the full list. Spacing and ordering of the parameters within the template is irrelevant and does not affect the final, rendered text.

{{Citation |last= |first= |year= |title= |publisher= |publication-place= |page= |url= |access-date=}}

{{Citation
| last        =
| first       =
| year        =
| title       =
| publisher   =
| publication-place =
| page        =
| url         =
| access-date =
}}
  • last: The author's surname or last name. Don't use with the author parameter.
  • first: The author's first or given name(s).
  • year: Year of authorship or publication. Mandatory for use with links from Template:Harvard citation, unless |date= specifies both month and year.
  • title: Title of the work. Mandatory for web references.
  • publisher: The name of the publisher. Omit terms such as Publishers, Co., Inc., Ltd., etc., but retain the words Books or Press. Not normally included where the publication is a periodical which has its own Wikipedia article (e.g. Newsweek, Billboard).
    • publication-place (or place or location): The city of publication. If more than one town/city is listed on the title page, give the first one or the location of the publisher's head office. Omit when the publication is a periodical whose name specifies the location (e.g. The New York Times, The Times of India)
  • page: For use when one page is cited. Adds "p." before the page number. Do not use with pages.
  • url: A url of an online location where the item can be found. If the url includes double quotes, these must be encoded as "%22".
    • access-date: Date[n 1] when the url was accessed.

Example

{{Citation
| last      = Turner
| first     = Orsamus
| title     = History of the pioneer settlement of
Phelps and Gorham's purchase, and Morris' reserve
| publisher = William Alling
| place     = Rochester, New York
| year      = 1851
| ol        = 7120924W
}}
Lua error: bad argument #1 to "get" (not a valid title).

Full citation parameters

Template:Notice These can be used for all types of publication. All are optional and indentation is used simply to group related items — these may be mutually exclusive where indicated. Some hyphenated names can also be placed without hyphens.

{{Citation
| author  =
| last    =
| first   =
| author2 =
| last2   =
| first2  =
| author-link  =
| author2-link =
| author-separator =
| author-name-separator =
| author-mask =
| display-authors =
| editor        =
| editor-last   =
| editor-first  =
| editor2       =
| editor2-last  =
| editor2-first =
| editor-link   =
| editor2-link  =
| translator-last =
| translator-first =
| translator-link = 
| translator2-last =
| translator2-first =
| translator2-link =
| others   =
| publication-date =
| date     =
| year     =
| origyear =
| title    =
| chapter  =
| chapter-url  =
| chapter-format  =
| contribution =
| contribution-url =
| type    =
| journal =
| periodical =
| newspaper  =
| magazine   =
| encyclopedia =
| work =
| edition =
| series  =
| volume  =
| issue   =
| publisher =
| publication-place =
| place    =
| language =
| page  =
| pages =
| nopp  =
| at   =
| id   =
| isbn =
| issn =
| oclc =
| pmid =
| pmc  =
| bibcode =
| doi =
| doi-inactive-date=
| zbl =
| url =
| access-date  =
| format      =
| archive-url  =
| archive-date =
| url-status    =
| quote      =
| layurl =
| laysource  =
| laydate    =
| separator  =
| postscript =
| ref =
}}

Parameters

Syntax

Nested parameters rely on their parent parameters:

  • parent
  • OR: parent2—may be used instead of parent
    • child—may be used with parent (and is ignored if parent is not used)
    • OR: child2—may be used instead of child (and is ignored if parent2 is not used)
Where aliases are listed, only one of the parameters may be defined; if multiple aliased parameters are defined, then only one will show.

By default, sets of fields are terminated with a comma (,).

COinS

This template embeds COinS metadata in the HTML output, allowing reference management software to retrieve bibliographic metadata. See Wikipedia:COinS. As a general rule, only one data item per parameter. Do not include explanatory or alternate text:

  • use |date=27 September 2007 not |date=27 September 2007 (print version 25 September)

Use of templates within the citation template is discouraged because many of these templates will add extraneous HTML or CSS that will be included raw in the metadata. Also, HTML entities, for example &nbsp;, &ndash;, or &#160;, should not be used in parameters that contribute to the metadata.

COinS metadata is created for these parameters

Note: This table of metadata is displayed in the documentation of all Citation Style 1 templates. Not all of these parameters are supported by every CS1 template. Some of these parameters are mutually exclusive, some are aliases of another parameter, and some require other parameters to be present. A full list of this template's supported parameters, their aliases, and their dependencies is shown in the Usage section near the top of this documentation page.

  • |periodical=, |journal=, |newspaper=, |magazine=, |work=, |website=, |encyclopedia=, |encyclopaedia=, |dictionary=
  • |chapter=, |script-chapter=, |contribution=, |script-contribution=, |entry=, |script-entry=, |article=, |script-article=, |section=, |script-section=
  • |title=, |script-title=, |book-title=
  • |publication-place=, |place=, |location=
  • |date=, |year=, |publication-date=
  • |series=, |version=
  • |volume=, |issue=, |number=
  • |page=, |pages=, |at=, |quote-page=, |quote-pages=
  • |edition=
  • |publisher=, |institution=
  • |url=, |chapter-url=, |contribution-url=, |section-url=
  • |author-last=, |author-last#=, |author#-last=, |author-surname=, |author-surname#=, |author#-surname=, |last=, |last#=, |surname=, |surname#=, |author=, |author#=, |subject=, |subject#=, |host=, |host#=
  • |author-first=, |author-first#=, |author#-first=, |author-given=, |author-given#=, |author#-given=, |first=, |first#=, |given=, |given#=
  • |degree=
  • |arxiv=, |bibcode=, |biorxiv=, |citeseerx=, |doi=, |eissn=, |eprint=, |hdl=, |isbn=, |issn=, |jfm=, |jstor=, |lccn=, |message-id=, |mr=, |oclc=, |osti=, |pmc=, |pmid=, |rfc=, |ssrn=, |s2cid=, |zbl=

What's new

What's new or changed recently
Parameter Description Date
N/A

Deprecated

{{#lst:Help:CS1 errors|deprecated_params_table}} {{#lst:Help:CS1 errors|deleted_params_table}}

Description

Authors

  • last: Surname of a single author. Do not wikilink—use author-link instead. For corporate authors or authors for whom only one name is listed by the source, use last or one of its aliases (e.g. |author=Bono). Aliases: surname, author, last1, surname1, author1.
    • author: this parameter is used to hold the name of an organizational author (e.g. a committee) or the complete name (first and last) of a single person; for the latter, prefer the use of |first= and |last=. This parameter should never hold the names of more than one author. Supports accept-this-as-written markup. Do not use italics in this field, as doing so produces corrupt metadata.
    • first: Given or first names of author; for example: Firstname Middlename or Firstname M. or Firstname M. Sr. Do not wikilink—use author-link instead. Aliases: given, first1, given1. Requires last; first name will not display if last is empty. Use generational and regnal suffixes only in accordance with MOS:JRSR and use honorifics (including Dr., Sir, and similar) only in accordance with MOS:HON.
    • OR: for multiple authors, use last1, first1 through lastn, firstn, where n is any consecutive number for an unlimited number of authors (each firstn requires a corresponding lastn, but not the other way around). See the display parameters to change how many authors are displayed. Aliases: surname1, given1 through surnamen, givenn, or author1 through authorn. For an individual author plus an institutional author, you can use |first1=...|last1=...|author2=....
    • author-link: Title of existing Wikipedia article about the author—not the author's website; do not wikilink. Aliases: author-link1, author1-link, authorlink.
    • OR: for multiple authors, use author-link1 through author-linkn. Aliases: author1-link through authorn-link.
    • name-list-style: accepts a limited list of keywords as value; when set to amp, ampersand, or &, inserts an ampersand between the last two names in a name list; when set to and, inserts the conjunction 'and' between the last two names of a name list; when set to vancdisplays name lists in Vancouver style when the lists use the last/first forms of name parameters.
  • vauthors: comma-separated list of author names in Vancouver style; enclose corporate or institutional author names in doubled parentheses. End with etal if appropriate:
    |vauthors=Smythe JB, ((Megabux Corp.)), etal
    • author-link and author-mask may be used for the individual names in |vauthors= as described above
  • authors: deprecated Free-form list of author names; use of this parameter is discouraged because it does not contribute to a citation's metadata; not an alias of last.
  • contributor-last: (book cites only) surname of the author of contribution (which is required). Aliases: contributor-surname, contributor1, contributor1-last, contributor-last1. Supports accept-this-as-written markup.
    • contributor-first: Given or first names of contributor. Do not wikilink—use contributor-link instead. Aliases: contributor-given, contributor1-first, contributor-first1.
    • OR: for multiple contributors, use contributor-last1, contributor-first1 through contributor-lastn, contributor-firstn where n is any consecutive number for an unlimited number of contributors (each contributor-firstn requires a corresponding contributor-lastn, but not the other way around). Aliases: contributor1-last, contributor1-first through contributorn-last, contributorn-first, or contributor1 through contributorn.
    • contributor-link: Title of existing Wikipedia article about the contributor—not the contributor's website; do not wikilink. Aliases: contributor-link1, contributor1-link.
    • OR: for multiple contributors, use contributor-link1 through contributor-linkn. Aliases: contributor1-link through contributorn-link.
  • translator-last: Surname of translator. Do not wikilink—use translator-link instead. Aliases: translator-surname, translator1, translator1-last, translator-last1. Supports accept-this-as-written markup.
    • translator-first: Given or first names of translator. Do not wikilink—use translator-link instead. Aliases: translator-given, translator1-first, translator-first1.
    • OR: for multiple translators, use translator-last1, translator-first1 through translator-lastn, translator-firstn, where n is any consecutive number for an unlimited number of translators (each translator-firstn requires a corresponding translator-lastn, but not the other way around). Aliases: translator1-last, translator1-first through translatorn-last, translatorn-first, or translator1 through translatorn.
    • translator-link: Title of existing Wikipedia article about the translator—not the translator's website; do not wikilink. Aliases: translator-link1, translator1-link.
    • OR: for multiple translators, use translator-link1 through translator-linkn. Aliases: translator1-link through translatorn-link.
  • collaboration: Name of a group of authors or collaborators; requires author, last, or vauthors listing one or more primary authors; follows author name-list; appends "et al." to author name-list.
  • others: To record other contributors to the work, including illustrators. For the parameter value, write Illustrated by John Smith.

Editors

  • editor-last: surname of editor. Do not wikilink—use editor-link instead. Where the surname is usually written first—as in Chinese—or for corporate authors, simply use editor-last to include the same format as the source. Aliases: editor-last1, editor1-last, editor-surname, editor-surname1, editor1-surname, editor, editor1.
    • editor: This parameter is used to hold the complete name of a single editor (first and last), or the name of an editorial committee. This parameter should never hold the names of more than one editor. Supports accept-this-as-written markup.
    • editor-first: given or first names of editor, including title(s); example: Firstname Middlename or Firstname M. or Dr. Firstname M., Sr. Do not wikilink—use editor-link instead. Aliases: editor-first1, editor1-first, editor-given, editor-given1, editor1-given.
    • OR: for multiple editors, use editor-last1, editor-first1 through editor-lastn, editor-firstn (Aliases: editorn-last, editor-surnamen or editorn-surname; editorn-first, editor-givenn or editorn-given; editorn). For an individual editor plus an institutional editor, you can use |editor-first1=...|editor-last1=... |editor2=....
    • editor-link: title of existing Wikipedia article about the editor—not the editor's website; do not wikilink. Aliases: editor-link1.
    • OR: for multiple editors, use editor-link1 through editor-linkn (alias editorn-link).
    • name-list-style: accepts a limited list of keywords as value; when set to amp, ampersand, or &, inserts an ampersand between the last two names in a name list; when set to and, inserts the conjunction 'and' between the last two names of a name list; when set to vancdisplays name lists in Vancouver style when the lists use the last/first forms of name parameters.
  • veditors: comma separated list of editor names in Vancouver style; enclose corporate or institutional names in doubled parentheses. End with etal if appropriate:
    |veditors=Smythe JB, ((Megabux Corp.)), etal
    • editor-linkn and editor-maskn may be used for the individual names in |veditors=, as described above
  • Display:
    Use display-editors to control the length of the displayed editor name list and to specify when "et al." is included.
    If authors: Authors are first, followed by the included work, then "In" and the editors, then the main work.
    If no authors: Editors appear before the included work; a single editor is followed by "ed."; multiple editors are followed by "eds."

Title

(See also Help:Citation Style 1 § Titles and chapters.)

  • title: Title of source. Can be wikilinked to an existing Wikipedia article or url may be used to add an external link, but not both. If work (or its alias) is defined, then title is displayed in quotes; otherwise, title displays in italics. If script-title is defined, use title to hold a Romanization (if available) of the title in script-title.
    • script-title: Original title for languages that do not use a Latin-based script (Arabic, Chinese, Cyrillic, Greek, Hebrew, Japanese, Korean, etc.); not italicized, follows italicized Romanization defined in title (if present). Must be prefixed with one of the supported language codes to help browsers properly display the script:
      ... |title=Tōkyō tawā |script-title=ja:東京タワー |trans-title=Tokyo Tower ...
    • trans-title: English translation of the title if the source cited is in a foreign language. Displays in square brackets after title. Use of the language parameter is recommended.
Titles containing certain characters will not display and link correctly unless those characters are encoded.
newline [ ] |
space &#91; &#93; {{!}} (preferred)
{{bracket|text}} &#124; or {{pipe}}see also Help:Table § Rendering the pipe
  • title-link: Title of existing Wikipedia article about the source named in title – do not use a web address; do not wikilink.
  • chapter: The chapter heading of the source. May be wikilinked or may use chapter-url, but not both. Displays in quotes. If script-chapter is defined, use chapter to hold a Romanization (if available) of the title in script-chapter
    • script-chapter: Chapter heading for languages that do not use a Latin-based script (Arabic, Chinese, Cyrillic, Greek, Hebrew, Japanese, Korean, etc); follows Romanization defined in chapter (if present). Must be prefixed with one of the supported language codes to help browsers properly display the script:
      ... |chapter=Tōkyō tawā |script-chapter=ja:東京タワー |trans-chapter=Tokyo Tower ...
    • trans-chapter: English translation of the chapter heading, if the source cited is in a foreign language. Displays in square brackets after the chapter field; if chapter-url is defined, then trans-chapter is included in the link. Use of the language parameter is recommended.
  • contribution: A separately-authored part of author's book. May be wikilinked or may use contribution-url, but not both. Values of Afterword, Foreword, Introduction, or Preface will display unquoted; any other value will display in quotation marks. The author of the contribution is given in contributor.
  • type: Provides additional information about the media type of the source. May alternatively be used to identify the type of manuscript linked to in the title, if this is not the final version of a manuscript (e.g. if a preprint of a manuscript is freely available, but the version of record is behind a paywall). Format in sentence case. Displays in parentheses following the title. The reserved keyword none can be used to disable the display of a type. Examples: Thesis, Booklet, Accepted manuscript, CD liner, Press release. Alias: medium.
  • Lua error: bad argument #1 to "get" (not a valid title).: The language (or a comma-separated list of the languages) in which the source is written, as either the ISO 639 language code (preferred) or the full language name. Examples: |language=ru; |lang=fr, pt-br; |lang=Russian; |language=French, Portuguese. See the list of supported codes and names. Do not use templates or wikilinks. Displays in parentheses with "in" before the language name or names. When the only source language is English, no language is displayed in the citation. The use of languages recognized by the citation module adds the page to the appropriate subcategory of Category:CS1 foreign language sources. Because cs1|2 templates are often copied from en.wiki to other wikis, the use of language codes is preferred so that language names render in the correct language and form, e.g. español at a French-language wiki instead of the English word "Spanish". Aliases: Lua error: bad argument #1 to "get" (not a valid title).

Date

  • date: Date of referenced source. Can be full date (day, month, and year) or partial date (month and year, season and year, or year). Use same format as other publication dates in the citations.[date 1] Do not wikilink. Displays after the authors and is enclosed in parentheses. If there is no author, then displays after the website and publisher. For acceptable date formats, see Help:Citation Style 1 § Dates.
Shortened footnotes target full citations using the year specified in this parameter. A lowercase letter may be suffixed to the year to disambiguate {{sfn}} links to multiple works by the same author in the same year,[more] unless the date is formatted as YYYY-MM-DD. In the latter case, year or ref is required to disambiguate the link targets.
For approximate year, precede with "c. ", like this: |date=c. 1900.

For no date, or "undated", use |date=n.d.
The date of a Web page, PDF, etc. with no visible date can sometimes be established by searching the page source or document code for a created or updated date; a comment for editors such as date=2021-12-25<!--date from page source-->|orig-date=Original date 2011-01-01 can be added.
Automatic date formatting: Citation Style 1 and 2 templates, including this template, automatically render dates in all date parameters (such as |date=, |publication-date=, |access-date=, |archive-date=, etc.) except for |orig-date= in the style specified by the article's {{use dmy dates}} or {{use mdy dates}} template. See those templates' documentation for details.
  • year: Year of publication. The more flexible |date= parameter also handles a year by itself. Do not use in combination with the |date= parameter, unless both of the following conditions are met:
    1. Shortened footnotes target multiple citations with same last name and year of publication. (This situation necessitates a CITEREF disambiguator, usually a lowercase letter suffixed to the year.)
    2. The |date= format is YYYY-MM-DD. (This format prevents the addition of a disambiguating letter to the year.)
  • orig-date: Original publication date or year; displays in square brackets after the date (or year). For clarity, please supply specifics. For example: |orig-date=First published 1859 or |orig-date=Composed 1904. As |orig-date= does not support automatic date formatting, use the same date format as defined by |df= (or, if it exists in the article, by |cs1-dates= of a {{use dmy dates}} or {{use mdy dates}} template), or as used in the |date= parameter. Alias: orig-year
  • df: date format; sets rendered dates to the specified format; does not support date ranges or seasonal dates; overrides the automatic date formatting described above. Accepts one value which may be one of these:
    dmy – set publication dates to day month year format; access- and archive-dates are not modified;
    mdy – as above for month day, year format
    ymd – as above for year initial numeric format YYYY-MM-DD
    dmy-all – set publication, access-, and archive-dates to day month year format;
    mdy-all – as above for month day, year format
    ymd-all – as above for year initial numeric format YYYY-MM-DD
  1. Publication dates in references within an article should all have the same format. This may be a different format from that used for archive and access dates. See MOS:DATEUNIFY.

Work

  • work (required by {{cite journal}} and {{cite magazine}}): Name of the work containing the source; may be wikilinked if relevant. Displays in italics. If the name of the periodical changed over time use the name at the time of the source's publication. If script-work is defined, use work to hold a Romanization (if available) of the title in script-work. Aliases: journal, newspaper, magazine, periodical, website. Use Latin script. For languages written in non-Latin based scripts (Arabic, Chinese, Cyrillic, Greek, Hebrew, Indic, Japanese, Korean, etc.) use a standard Romanization in this field.
    • script-work: Work title in its original, non-Latin script; not italicized, follows italicized Romanization defined in work (if present). Must be prefixed with one of the supported language codes to help browsers properly display the script. Leave empty for Latin-based scripts (Czech, French, Turkish, Vietnamese, etc.). Aliases: script-journal, script-newspaper, script-magazine, script-periodical, script-website.
    • trans-work: English translation of the work title if the source cited is in a foreign language. Displays in square brackets after work or script-work. Aliases: trans-journal, trans-newspaper, trans-magazine, trans-periodical, trans-website.
      ... |work=Zhōngguó piàofáng |script-work=zh:中国票房 |trans-work=China Box Office ...
    • issue: When the publication is one of a series that is published periodically. Alias: number. When the issue has a special title of its own, this may be given, in italics, along with the issue number, e.g. |issue=2, ''Modern Canadian Literature''. Please choose either |issue= or |number= depending on what is used in the actual publication. If a publication carries both issue and number designations (typically one being a year-relative and the other an absolute value), provide them both, for example |issue=2 #143. Displayed in parentheses following volume.
When set, work changes the formatting of other parameters in the same citation:
title is not italicized and is enclosed in quotes.
chapter does not display (and will produce an error message).

Publisher

  • publisher: Name of publisher; may be wikilinked[1] if relevant. The publisher is the company, organization or other legal entity that publishes the work being cited. For self-published works (i.e., where the publisher is the same as the author or creator) state |publisher=self-published.[2] Do not use the publisher parameter for the name of a work (e.g. a website, book, encyclopedia, newspaper, magazine, journal, etc.). If the name of the publisher changed over time, use the name as stated in the publication or used at the time of the source's publication. Corporate designations such as "Ltd", "Inc.", or "GmbH" are not usually included. Not normally used for periodicals. Omit where the publisher's name is substantially the same as the name of the work (for example, The New York Times Co. publishes The New York Times newspaper, so there is no reason to name the publisher). Displays after title.
  • place: For news stories with a dateline, the location where the story was written. If the name of the location changed over time, use the name as stated in the publication or used at the time of the source's publication. In earlier versions of the template this was the publication place, and for compatibility, will be treated as the publication place if the publication-place parameter is absent; see that parameter for further information. Alias: location
  • publication-place: Geographical place of publication; generally not wikilinked; omit when the name of the work includes the publication place, for example, The Boston Globe, The Times of India. Displays after the title. If the name of the publication place changed over time, use the name as stated in the publication or used at the time of the source's publication. If only one of publication-place, place, or location is defined, it will be treated as the publication place and will show after the title; if publication-place and place or location are defined, then place or location is shown before the title prefixed with "written at" and publication-place is shown after the title.
  • publication-date: Date of publication when different from the date the work was written. If date (or year) is also defined and is different, then publication-date displays preceded by "published" and enclosed in parentheses, following publisher. If date (or year) is not defined, publication-date is displayed as date. Use the same format as other dates in the article; do not wikilink.
  • via: Name of the content deliverer (if different from publisher). via is not a replacement for publisher, but provides additional detail. It may be used when the content deliverer (e.g. NewsBank) presents the source in a format different from the original, when the URL provided does not make clear the identity of the deliverer, where no URL or DOI is available (EBSCO), or if the deliverer requests attribution. See the access level parameters to display access restrictions.

Edition, series, volume

  • edition: When the publication has more than one edition; for example: "2nd", "Revised", and so forth. Appends the string " ed." after the field, so |edition=2nd produces "2nd ed." Does not display if a periodical field is defined.
  • series or version: When the source is part of a series, such as a book series or a journal, where the issue numbering has restarted.
  • volume: For one publication published in several volumes. Displays after the title and series fields; volume numbers should be entered just as a numeral (e.g. 37). Volume values that are wholly digits, wholly uppercase Roman numerals, or fewer than five characters will appear in bold. Any alphanumeric value of five or more characters will not appear in bold. In rare cases, publications carry both an ongoing volume and a year-related value; if so, provide them both, for example |volume=IV / #10.

In-source locations

  • page: The number of a single page in the source that supports the content. Use either |page= or |pages=, but not both. Displays preceded by p. unless |no-pp=yes. If hyphenated, use {{hyphen}} to indicate this is intentional (e.g. |page=3{{hyphen}}12), otherwise several editors and semi-automated tools will assume this was a misuse of the parameter to indicate a page range and will convert |page=3-12 to |pages=3{{ndash}}12. Alias: p.
  • OR: pages: A range of pages in the source that supports the content. Use either |page= or |pages=, but not both. Separate using an en dash (–); separate non-sequential pages with a comma (,); do not use to indicate the total number of pages in the source. Displays preceded by pp. unless |no-pp=yes.
    Hyphens are automatically converted to en dashes; if hyphens are appropriate because individual page numbers contain hyphens, for example: pp. 3-1–3-15, use double parentheses to tell the template to display the value of |pages= without processing it, and use {{hyphen}} to indicate to editors that a hyphen is really intended: |pages=((3{{hyphen}}1{{ndash}}3{{hyphen}}15)). Alternatively, use |at=, like this: |at=pp. 3-1&ndash;3-15. Alias: pp.
    • no-pp: Set to yes, y, or true to suppress the p. or pp. notations where this is inappropriate; for example, where |page=Front cover or |pages=passim.
  • OR: at: For sources where a page number is inappropriate or insufficient. Overridden by |page= or |pages=. Use only one of |page=, |pages=, or |at=.
    Examples: page (p.) or pages (pp.); section (sec.), column (col.), paragraph (para.); track; hours, minutes and seconds; act, scene, canto, book, part, folio, stanza, back cover, liner notes, indicia, colophon, dust jacket, verse.
  • For |quote-page= and |quote-pages= used in conjunction with |quote=, see here.

URL

  • url: URL of an online location where the text of the publication named by title can be found. Cannot be used if title is wikilinked. If applicable, the link may point to the specific page(s) referenced. Remove tracking parameters from URLs, e.g. #ixzz2rBr3aO94 or ?utm_source=google&utm_medium=...&utm_term=...&utm_campaign=.... For linking to pages in PDF files or in Google Books, see WP:PAGELINKS. Do not link to any commercial booksellers, such as Amazon; use |isbn= or |oclc= to provide neutral search links for books. Invalid URLs, including those containing spaces, will result in an error message.
    • access-date: Full date when the content pointed to by url was last verified to support the text in the article; do not wikilink; requires url; use the same format as other access and archive dates in the citations.[date 1] Not required for linked documents that do not change. For example, access-date is required for online sources, such as personal websites, that do not have a publication date; see WP:CITEWEB. Access dates are not required for links to published research papers or published books. Note that access-date is the date that the URL was found to be working and to support the text being cited. See "Automatic date formatting" above for details about interaction with {{use dmy dates}} and {{use mdy dates}}. Can be hidden or styled by registered editors. Alias: accessdate.
    • archive-url: The URL of an archived snapshot of a web page. Typically used to refer to services such as Internet Archive (see Wikipedia:Using the Wayback Machine) and archive.today (see Help:Using archive.today); requires archive-date and url. By default (overridden by |url-status=live) the archived link is displayed first, with the original link at the end. Alias: archiveurl.
      • archive-date: Archive-service snapshot-date; preceded in display by default text "archived from the original on". Use the same format as other access and archive dates in the citations. This does not necessarily have to be the same format that was used for citing publication dates.[date 1] Do not wikilink; templated dates are discouraged. See "Automatic date formatting" above for details about interaction with {{use dmy dates}} and {{use mdy dates}}. Alias: archivedate.
      • url-status: A control parameter to select one of |url= or |archive-url= to link |title=; requires url and archive-url. Use {{dead link}} to mark dead |url= when there is no |archive-url=.
        Accepts multiple keywords:
        • dead – (default condition when |url-status= omitted or empty) selects |archive-url=
        • live – selects |url=; used when |url= is preemptively archived with |archive-url=
        • deviated – selects |archive-url=; used when |url= is still 'live' but no-longer supports the text in a Wikipedia article
        • unfit – selects |archive-url=; used when |url= links to vice (gambling, pornography), advertising, or other unsuitable page; links to |url= are suppressed in the rendering. If an entire domain is unsuitable, consider instead usurpation or blacklist. Bot help is available at WP:URLREQ
        • usurped – selects |archive-url=; used when the domain in |url= no longer serves its original intent, particularly when the domain has been (mis)appropriated by other entities, such as vice, reseller and advertising sites; links to |url= are suppressed in the rendering. Bot help is available at WP:URLREQ
        • bot: unknown – Editors may encounter this value which is left behind by a bot that has visited the reference and wasn't able to determine the status of the url. The page will be automatically placed in Category:CS1 maint: bot: original URL status unknown when this value is present, and per the instructions in that category, editors manually evaluate the state of the URL and change the parameter value appropriately.
      • archive-format: File format of the work referred to by archive-url; for example: DOC or XLS; displayed in parentheses after the archive link. HTML is implied and should not be specified. PDF is auto-detected and should not be specified. Does not change the external link icon (except for PDF). Note: External link icons do not include alt text; thus, they do not add file format information for the visually impaired. (This is not a concern with PDF, because the auto-detection will add "(PDF)" as descriptive text.) See Using |format=
    • url-access: See Access indicators for url-holding parameters
  • format: File format of the work referred to by url; for example: DOC or XLS; displayed in parentheses after title. (For media format, use type.) HTML is implied and should not be specified. PDF is auto-detected and should not be specified. Does not change the external link icon (except for PDF). Note: External link icons do not include alt text; thus, they do not add file format information for the visually impaired. (This is not a concern with PDF, because the auto-detection will add "(PDF)" as descriptive text.) See Using |format=

URLs must begin with a supported URI scheme. http:// and https:// will be supported by all browsers; however, ftp://, gopher://, irc://, ircs://, mailto: and news: may require a plug-in or an external application and should normally be avoided. IPv6 host-names are currently not supported.

If URLs in citation template parameters contain certain characters, then they will not display and link correctly. Those characters need to be percent-encoded. For example, a space must be replaced by %20. To encode the URL, replace the following characters with:

Character space " ' < > [ ] { | }
Encoding %20 %22 %27 %3C %3E %5B %5D %7B %7C %7D

Single apostrophes do not need to be encoded; however, unencoded multiples will be parsed as italic or bold markup. Single curly closing braces also do not need to be encoded; however, an unencoded pair will be parsed as the double closing braces for the template transclusion.

  1. 1.0 1.1 Access-date and archive-date in references should all have the same format – either the format used for publication dates, or YYYY-MM-DD. See MOS:DATEUNIFY.

Chapter URL

  • chapter-url: URL of an online location where the text of the publication named by chapter or contribution can be found. Cannot be used if those parameters are wikilinked. Should be at the same site as url, if any. If chapter-url is used, url should only be used if the beginning of the work and the cited chapter are on separate webpages at the site. Aliases: contribution-url, section-url.
  • chapter-format: Format of the work referred to by chapter-url; for example: PDF, DOC, or XLS; displayed in parentheses after chapter. HTML is implied and should not be specified. Does not change the external link icon. Note: External link icons do not include alt text; thus, they do not add format information for the visually impaired.

Anchor

  • Lua error: bad argument #1 to "get" (not a valid title).: the citation's HTML anchor identifier, when different from its default. When set, |ref=ID generates an anchor with the given ID (the id= attribute in the citation's <cite id="ID"> HTML tag). Setting |ref=ID identifies the template as a target and allows wikilinking to full references, especially useful with short-form citations like shortened notes and parenthetical referencing. The default anchor ID is suitable for use with {{sfn}} and {{harv}} templates. Since April 2020, the parameter / keyword pair |ref=harv has no special meaning; this deprecated setting should not be used and may be removed from existing cs1|2 templates. To inhibit anchor ID creation, set |ref=none. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..

Identifiers

  • id: A unique identifier, used where none of the specialized identifiers are applicable; wikilink or use an external link template as applicable. For example, |id=NCJ 122967 will append "NCJ 122967" at the end of the citation. You can use templates such as |id={{NCJ|122967}} to append NCJ 122967 instead.

The following identifiers create links and are designed to accept a single value. Using multiple values or other text will break the link and/or invalidate the identifier. In general, the parameters should include only the variable part of the identifier, e.g. |rfc=822 or |pmc=345678.

  • Lua error: bad argument #1 to "get" (not a valid title).: arXiv identifier; for example: |arxiv=hep-th/9205027 (before April 2007) or |arxiv=0706.0001 (April 2007 – December 2014) or |arxiv=1501.00001 (since January 2015). Do not include extraneous file extensions like ".pdf" or ".html". Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Amazon Standard Identification Number; if first character of Lua error: bad argument #1 to "get" (not a valid title). value is a digit, use Lua error: bad argument #1 to "get" (not a valid title).. Because this link favours one specific distributor, include it only if standard identifiers are not available. Example |asin=B00005N5PF. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
    • Lua error: bad argument #1 to "get" (not a valid title).: ASIN top-level domain for Amazon sites other than the US; valid values: {{#lst:Help:CS1 errors|asin-tld_values_list}}. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: bibcode; used by a number of astronomical data systems; for example: 1974AJ.....79..819H. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: bioRxiv id, as in the entire DOI (e.g. 10.1101/078733 for http://biorxiv.org/content/early/2016/10/01/078733 or https://doi.org/10.1101/078733; 10.1101/2020.07.24.220400 for https://doi.org/10.1101/2020.07.24.220400). Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: CiteSeerX id, a string of digits and dots found in a CiteSeerX URL (e.g. 10.1.1.176.341 for https://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.176.341). Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Digital object identifier; for example: 10.1038/news070508-7. It is checked to ensure it begins with (10.). Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
    • Supports accept-this-as-written markup to indicate valid DOIs using a non-standard format, see below.
    • Lua error: bad argument #1 to "get" (not a valid title).: Date a valid DOI was found to be non-working/inactive at https://doi.org. Use the same format as other dates in the article. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: International Standard Serial Number for the electronic media of a serial publication; eight characters may be split into two groups of four using a hyphen, but not an en dash or a space; example |eissn=1557-2986. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
    • Supports accept-this-as-written markup to indicate valid eISSNs using a non-standard format, see below.
  • Lua error: bad argument #1 to "get" (not a valid title).: Handle System identifier for digital objects and other resources on the Internet; example |hdl=20.1000/100. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: International Standard Book Number; for example: 978-0-8126-9593-9. (See Wikipedia:ISBN and ISBN § Overview.) Hyphens in the ISBN are optional, but preferred. Use the ISBN actually printed on or in the book. Use the 13-digit ISBN – beginning with 978 or 979 – when it is available. If only a 10-digit ISBN is printed on or in the book, use it. ISBNs can be found on the page with the publisher's information – usually the back of the title page – or beneath the barcode as a number beginning with 978 or 979 (barcodes beginning with any other numbers are not ISBNs). For sources with the older 9-digit SBN system, use Lua error: bad argument #1 to "get" (not a valid title).. Do not convert a 10-digit ISBN to 13-digit by just adding the 978 prefix; the last digit is a calculated check digit and just making changes to the numbers will make the ISBN invalid. This parameter should hold only the ISBN without any additional characters. It is checked for length, invalid characters – anything other than numbers, spaces, and hyphens, with "X" permitted as the last character in a 10-digit ISBN – and the proper check digit. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
    • Use the {{Format ISBN}} template within the parameter – in the form |isbn={{Format ISBN|9780812695939}} – if you are unsure of how any particular ISBN should be hyphenated, as the pattern varies by country and publisher.
    • Supports accept-this-as-written markup to indicate valid ISBNs using a non-standard format, see below.
  • Lua error: bad argument #1 to "get" (not a valid title).: International Standard Music Number; for example: 979-0-9016791-7-7. Hyphens or spaces in the ISMN are optional. Use the ISMN actually printed on or in the work. This parameter should hold only the ISMN without any additional characters. It is checked for length, invalid characters – anything other than numbers, spaces, and hyphens – and the proper check digit. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: International Standard Serial Number; eight characters may be split into two groups of four using a hyphen, but not an en dash or a space; example |issn=2049-3630. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
    • Supports accept-this-as-written markup to indicate valid ISSNs using a non-standard format, see below.
  • Lua error: bad argument #1 to "get" (not a valid title).: Jahrbuch über die Fortschritte der Mathematik; do not include "JFM" in the value; example |jfm=53.0144.01. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: JSTOR reference number; for example: |jstor=3793107. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Library of Congress Control Number. When present, alphabetic prefix characters are to be lower case and without a space; example |lccn=79-57364 or |lccn=2004042477 or |lccn=e09001178. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Mathematical Reviews; example |mr=630583. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: OCLC Number for looking up publications in the WorldCat union catalog; example |oclc=9355469. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Open Library identifier; do not include "OL" in the value; example |ol=7030731M. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Office of Scientific and Technical Information; example |osti=4367507. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: PubMed Central; use article number for open repository full-text of a journal article, e.g. |pmc=345678. Do not include "PMC" in the value. See also the Lua error: bad argument #1 to "get" (not a valid title). parameter, below; these are two different identifiers. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
    • Lua error: bad argument #1 to "get" (not a valid title).: Date that Lua error: bad argument #1 to "get" (not a valid title). goes live; if this date is in the future, then Lua error: bad argument #1 to "get" (not a valid title). is not linked until that date. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: PubMed; use unique identifier; example |pmid=17322060 See also the Lua error: bad argument #1 to "get" (not a valid title). parameter, above; these are two different identifiers. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Request for Comments; example |rfc=3143. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Standard Book Number; example |sbn=356-02201-3. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
    • Supports accept-this-as-written markup to indicate valid SBNs using a non-standard format, see below.
  • Lua error: bad argument #1 to "get" (not a valid title).: Social Science Research Network; example |ssrn=1900856. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Semantic Scholar corpus ID; example |s2cid=37220927. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..
  • Lua error: bad argument #1 to "get" (not a valid title).: Zentralblatt MATH; example |zbl=0472.53010 For zbMATH search results like JFM 35.0387.02 use |jfm=35.0387.02. Aliases: Lua error: bad argument #1 to "get" (not a valid title)..

In very rare cases, identifiers are published which do not follow their defined standard format or use non-conforming checksums. These would typically cause an error message to be shown. Do not alter them to match a different checksum. In order to suppress the error message, some identifiers (|doi=, |eissn=, |isbn=, |issn=, and |sbn=) support a special accept-this-as-written markup which can be applied to disable the error-checking (as |<param>=((<value>))). If the problem is down to a mere typographical error in a third-party source, correct the identifier value instead of overriding the error message.

For some identifiers, it is possible to specify the access status using the corresponding |<param>-access= parameter.

For {{cite journal}}, some identifiers (specifying free resources) will automatically be linked to the title when |url= and |title-link= are not used to specify a different link target. This behaviour can be overridden by one out of a number of special keywords for |title-link= to manually select a specific source (|title-link=pmc or |title-link=doi) for auto-linking or to disable the feature (|title-link=none).

It is not necessary to specify a URL to a link identical to a link also produced by an identifier. The |url= parameter (or |title-link=) can then be used for providing a direct deep link to the corresponding document or a convenience link to a resource that would not otherwise be obviously accessible.

Quote

  • quote: Relevant text quoted from the source. Displays enclosed in quotes. If script-quote is defined, use quote to hold a Romanization (if available) of the text in script-quote.
    • script-quote: Original quotation for languages that do not use a Latin-based script (Arabic, Chinese, Cyrillic, Greek, Hebrew, Japanese, Korean, etc.); not italicized, follows italicized Romanization defined in quote (if available). Alias: none. Must be prefixed with one of the supported language codes to help browsers properly display the script:
      ... |quote=Tōkyō tawā |script-quote=ja:東京タワー |trans-quote=Tokyo Tower ...
    • trans-quote: English translation of the quotation if the source quoted is in a foreign language. Displays in square brackets. Alias: none.
  • quote-page: The number of a single page quoted in |quote=. Use either |quote-page= or |quote-pages=, but not both. Should be a subset of the page(s) specified in |page=, |pages= or |at=. Displays preceded by p. unless |no-pp=yes. If hyphenated, use {{hyphen}} to indicate this is intentional (e.g. |quote-page=3{{hyphen}}12). Alias: none.
  • OR: quote-pages: A list or range of pages quoted in |quote=. Use either |quote-page= or |quote-pages=, but not both. Should be a subset of the pages specified in |pages= or |at=. Separate using an en dash (–); separate non-sequential pages with a comma (,). Displays preceded by pp. unless |no-pp=yes is defined. Hyphens are automatically converted to en dashes; if hyphens are appropriate because individual page numbers contain hyphens, for example: pp. 3-1–3-15, use double parentheses to tell the template to display the value of |quote-pages= without processing it, and use {{hyphen}} to indicate to editors that a hyphen is really intended: |quote-pages=((3{{hyphen}}1{{ndash}}3{{hyphen}}15)). Alias: none.

Laysummary

Lua error: expandTemplate: template "Citation Style documentation/lay" does not exist.

Display options

  • mode: Sets element separator, default terminal punctuation, and certain capitalization according to the value provided. For |mode=cs1, element separator and terminal punctuation is a period (.); where appropriate, initial letters of certain words are capitalized ('Retrieved...'). For |mode=cs2, element separator is a comma (,); terminal punctuation is omitted; where appropriate, initial letters of certain words are not capitalized ('retrieved...'). These styles correspond to Citation Style 1 and Citation Style 2 respectively. To override default terminal punctuation use postscript.
  • author-mask:
  • contributor-mask:
  • editor-mask:
  • interviewer-mask:
  • subject-mask:
  • translator-mask:
    Replaces the name of the (first) author with em dashes or text. Set <name>-mask to a numeric value n to set the dash n em spaces wide; set <name>-mask to a text value to display the text without a trailing author separator; for example, "with". The numeric value 0 is a special case to be used in conjunction with <name>-link—in this case, the value of <name>-link will be used as (linked) text. In either case, you must still include the values for all names for metadata purposes. Primarily intended for use with bibliographies or bibliography styles where multiple works by a single author are listed sequentially such as shortened footnotes. Do not use in a list generated by {{reflist}}, <references /> or similar as there is no control of the order in which references are displayed. Mask parameters can take an enumerator in the name of the parameter (e.g. |authorn-mask=) to apply the mask to a specific name.
  • display-authors:
  • display-contributors:
  • display-editors:
  • display-interviewers:
  • display-subjects:
  • display-translators:
    Controls the number of author (or other kind of contributor) names that are displayed. By default, all authors are displayed. To change the displayed number of names, set the parameter to the desired number. For example, |display-authors=2 will display only the first two authors in a citation (and not affect the display of the other kinds of contributors). |display-authors=0 is a special case suppressing the display of all authors including the et al. |display-authors=etal displays all authors in the list followed by et al. Aliases: none.
  • postscript: Controls the closing punctuation for a citation; defaults to none. Additional text, or templates that render more than a single terminating punctuation character, will generate a maintenance message. |postscript= is ignored if quote is defined.

Subscription or registration required

Citations of online sources that require registration or a subscription are acceptable in Wikipedia as documented in Verifiability § Access to sources. As a courtesy to readers and other editors, editors should signal restrictions on access to material provided via the external links included in a citation. These levels describe requirements or constraints related to accessing and viewing the cited material; they are not intended to indicate the ability to reuse, or the copyright status, of the material, since that status is not relevant to verifying claims in articles.

Four access levels can be used:

  • access indicator for named identifiers:
    • Freely accessible free: the source is free to read for anyone
  • access indicators for url-holding parameters:
    • Free registration required registration: a free registration with the provider is required to access the source, even if a limited preview, abstract or review may still be available without registration
    • Free access subject to limited trial, subscription normally required limited: free access is subject to limited trial and a subscription is normally required
    • Paid subscription required subscription: the source is only accessible via a paid subscription with the provider of the source ("paywall")

As there are often multiple external links with different access levels in the same citation, each value is attributed to a specific external link.

Access indicators for url-holding parameters

Online sources linked by |url=, |article-url=, |chapter-url=, |contribution-url=, |entry-url=, |map-url=, and |section-url= are presumed to be free-to-read. When they are not free-to-read, editors should mark those sources with the matching access-indicator parameter so that an appropriate icon is included in the rendered citation. Because the sources linked by these URL-holding parameters are presumed to be free-to-read, they are not marked as free. If the registration/limited/subscription access to the source goes dead and is no longer available, then remove the access-indicator parameter and add |archive-url= and |archive-date= values if possible.

URL-holding and access-indicator parameters
URL Access Allowed keywords
|url= |url-access= registration Free registration required
limited Free access subject to limited trial, subscription normally required
subscription Paid subscription required
|article-url= |article-url-access=
|chapter-url= |chapter-url-access=
|contribution-url= |contribution-url-access=
|entry-url= |entry-url-access=
|map-url= |map-url-access=
|section-url= |section-url-access=

For example, this cites a web page that requires registration but not subscription:

{{cite web |url=https://example.com/nifty_data.php |url-access=registration |date=2021-04-15 |title=Nifty example data}}

which renders as:

Lua error: bad argument #1 to "get" (not a valid title).
Access indicator for named identifiers

Links inserted by named identifiers are presumed to lie behind a paywall or registration barrier – exceptions listed below. When they are free-to-read, editors should mark those sources with the matching access-indicator parameter so that an appropriate icon is included in the rendered citation. When the sources linked by these named-identifier parameters are not presumed to carry a free-to-read full text (for instance because they're just abstracting services), they may not be marked as limited, registration, or subscription.

Named-identifier and access-indicator parameters
Identifier Access Allowed keywords
|bibcode= |bibcode-access= free Freely accessible
|doi= |doi-access=
|hdl= |hdl-access=
|jstor= |jstor-access=
|ol= |ol-access=
|osti= |osti-access=
|ssrn= |ssrn-access=
|s2cid= |s2cid-access=

Some named-identifiers are always free-to-read. For those named identifiers there are no access-indicator parameters; the access level is automatically indicated by the template. These named identifiers are:

  • |arxiv=
  • |biorxiv=
  • |citeseerx=
  • |medrxiv=
  • |pmc=
  • |rfc=

For embargoed Lua error: bad argument #1 to "get" (not a valid title). that will become available in the future, see Lua error: bad argument #1 to "get" (not a valid title)..

Tracking of free DOIs
  • The template is able to recognize known free-to-read DOI registrants, based on a list in Module:Citation/CS1/Configuration. Once a free registrant is identified, the 10.xxxx/... part of the DOI associated with the registrant can be added to the list under local function build_free_doi_registrants_table(). If |doi-access=free is not set, it will place the page in Category:CS1 maint: unflagged free DOI, which is routinely cleared by User:Citation bot.
  • The template is also able to recognize known free-to-read journals, assuming they have a clear 10.xxxx/yyyy.... DOI pattern. Once that pattern is identified, it can be added to Module:Citation/CS1/Configuration under local extended_registrants_t = { with the format ['XXXX'] = {'YYYY'},. If there are multiple journals with the same DOI prefix, they can be grouped together with the format ['XXXX'] = {'YYYY', 'ZZZZ', '...'},.
  • If you add a free registrant/free journal to the lists in Module:Citation/CS1/Configuration, leave a note at User talk:Citation bot so the bot knows about it.

Examples

Books

Three authors, a volume, and an edition. Ampersand (&) forced before final author's name.
{{Citation
| last1  = Lincoln
| first1 = A.
| last2  = Washington
| first2 = G.
| last3  = Adams
| first3 = J.
| name-list-style = amp
| title     = All the Presidents' Names
| publisher = The Pentagon
| place     = Home Base, New York
| volume  = XII
| edition = 2nd
| year    = 2007
}}
Lua error: bad argument #1 to "get" (not a valid title).

Web

Web page
{{Citation
| url   = http://nrhp.focus.nps.gov/
| title = NPS Focus
| work  = National Register of Historic Places
| publisher  = [[National Park Service]]
| access-date = November 30, 2010
| ref = none
}}
Lua error: bad argument #1 to "get" (not a valid title).
Archived page
{{Citation
| url = http://liftoff.msfc.nasa.gov/academy/space/atmosphere.html
| title = Earth's Atmosphere
| access-date = October 25, 2007
| publisher  = [[National Aeronautics and Space Administration]]
| year   = 1995
| author = NASA
| archive-url = https://web.archive.org/web/20071013232332/http://
liftoff.msfc.nasa.gov/academy/space/atmosphere.html
| archive-date = October 13, 2007
}}
Lua error: bad argument #1 to "get" (not a valid title).

Journals, newspapers, magazines, or other periodicals

Journal article
{{Citation
| last  = Hill
| first = Marvin S.
| title = Joseph Smith and the 1826
Trial: New Evidence and New
Difficulties
| journal = BYU Studies
| volume  = 12
| issue   = 2
| year    = 1976
| pages   = 1–8
| url     = https://byustudies.byu.edu/shop/PDFSRC/12.2Hill.pdf
}}
Lua error: bad argument #1 to "get" (not a valid title).
Journal article with multiple authors and identifier
{{Citation
| last1  = Mandelkern
| first1 = M
| last2  = Elias
| first2 = J
| last3  = Eden
| first3 = D
| last4  = Crothers
| first4 = D
| display-authors = 2
| title   = The dimensions of DNA in solution
| journal = J Mol Biol
| volume  = 152
| issue = 1
| pages = 153–161
| year  = 1981
| pmid  = 7338906
| doi   = 10.1016/0022-2836(81)90099-1
}}
Lua error: bad argument #1 to "get" (not a valid title).
Newspaper article
{{Citation
| last  = Smith
| first = Joseph III
| author-link = Joseph Smith III
| title = Last Testimony of Sister Emma
| newspaper = The Saints' Herald
| location = Plano, IL
| volume = 26
| issue  = 19
| date   = October 1, 1879
| page   = 289
| url    = http://www.sidneyrigdon.com/dbroadhu/
IL/sain1872.htm#100179
}}
Lua error: bad argument #1 to "get" (not a valid title).

Conference papers and public lectures

Conference paper
{{Citation
| last   = Sullivan
| first  = D.B.
| contribution = Time and frequency measurement
 at NIST: The first 100 years
| year   = 2001
| title  = 2001 IEEE Int'l Frequency Control Symp.
| publisher = National Institute of Standards and Technology
| contribution-url = http://tf.nist.gov/timefreq/general/pdf/1485.pdf
}}
Lua error: bad argument #1 to "get" (not a valid title).
Lecture
{{Citation
| last   = Habicht
| first  = Christian
| contribution = Hellenistic Athens and her Philosophers
| year   = 1988
| title  = David Magie Lecture, Princeton University Program in the History, Archaeology, and Religions of the Ancient World
| publisher = Princeton University
| page=14 
}}
Lua error: bad argument #1 to "get" (not a valid title).

Parts of books, including encyclopedia articles

Manuscript published in an edited compilation
{{Citation
| last  = Bidamon
| first = Emma Smith
| author-link = Emma Hale Smith
| chapter = Letter to Emma S. Pilgrim
| date = March 27, 1876
| editor-last  = Vogel
| editor-first = Dan
| title  = Early Mormon Documents
| volume = 1
| publisher = Signature Books
| publication-date = 1996
| isbn = 1-56085-072-8
}}
Lua error: bad argument #1 to "get" (not a valid title).
Work with an editor but no author
{{Citation
| editor-last  = Vogel
| editor-first = Dan
| title  = Early Mormon Documents
| volume = 1
| publisher = Signature Books
| date = 1996
| isbn = 1-56085-072-8
}}
Lua error: bad argument #1 to "get" (not a valid title).
Encyclopedia article by a named author
{{Citation
| last  = Kramer
| first = Martin
| author-link  = Martin Kramer
| year=1999
| title = Bernard Lewis
| editor-last  = Boyd
| editor-first = Kelley
| encyclopedia = Encyclopedia of Historians and Historical Writing
| volume = 1
| pages  = 719–720
| location = London
| publisher = Fitzroy Dearborn
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm
}}
Lua error: bad argument #1 to "get" (not a valid title).
Encyclopedia article with no named author
{{Citation
| title = Bernard Lewis
| editor-last = Boyd
| editor-first = Kelley
| year = 1999
| encyclopedia = Encyclopedia of Historians
and Historical Writing
| volume = 1
| pages = 719–720
| publisher = Fitzroy Dearborn
| location = London
| url = http://www.geocities.com/martinkramerorg/BernardLewis.htm
}}
Lua error: bad argument #1 to "get" (not a valid title).

Republications, or edited quotations in a periodical article

Manuscript edited and published in a journal
{{Citation
| last = Knight
| first = Joseph, Sr.
| year = 1833
| editor-last = Jessee
| editor-first = Dean
| title = Joseph Knight's Recollection
of Early Mormon History
| journal = BYU Studies
| volume = 17
| issue = 1
| publication-date = 1976
| page = 35
| url = https://byustudies.byu.edu/shop/PDFSRC/17.1Jessee.pdf
}}
Lua error: bad argument #1 to "get" (not a valid title).
Manuscript written at one date and place, then published in a periodical at a different date and place with commentary by the editor.
{{Citation
| last = Klingensmith
| first = Philip
| type = Affidavit
| date = September 5, 1872
| place = Lincoln County, Nevada
| title = Mountain Meadows Massacre
| editor-last = Toohy
| editor-first = Dennis J.
| journal = Corinne Daily Reporter
| publication-date = September 24, 1872
| publication-place = Corinne, Utah
| volume = 5
| issue = 252
| page = 1
| url = http://udn.lib.utah.edu/u?/corinne,5359
}}
Lua error: bad argument #1 to "get" (not a valid title).

Press release

Press release with quotation
{{Citation
| url = https://www.apple.com/pr/library/2010/04/05ipad.html
| title = Apple Sells Over 300,000 iPads First Day
| publisher = Apple Inc
| access-date = April 10, 2010
| quote = in the US as of midnight Saturday, April 3
| ref = none}}
Lua error: bad argument #1 to "get" (not a valid title).

Anchored citations

This template can generate a citation that can be combined with shortened footnotes or parenthetical referencing. It does this by creating an HTML anchor containing an ID. The special parameter |ref=harv generates an ID suitable for Harvard referencing templates such as {{harv}} as specified in the next section; this is the default for the {{citation}} template.

To disable anchor generation, specify |ref=none. You can also specify the ID directly, using the |ref=ID parameter. For example, suppose an article's References section contains the markup:

  • {{Citation |author=Sigmund Freud |title=Civilization and Its Discontents |date=1930 |ref=CivDis}}

which generates the citation:

  • Lua error: bad argument #1 to "get" (not a valid title).

Then, the markup "([[#CivDis|Freud 1930]])" generates a parenthetical reference "(Freud 1930)" containing a wikilink to the citation (try clicking on the wikilink).

Anchors for Harvard referencing templates

IDs compatible with Harvard referencing templates such as {{harv}} are computed from the last names of the authors (or editors, if no authors are given) and the year of the cited source. For example, the markup "{{harv|Wright|Evans|1851|p=ix}}" generates the Harvard reference "(Wright & Evans 1851, p. ix)", which wikilinks to the citation whose markup and appearance are shown below:

  • {{Citation |last1=Wright |first1=Thomas |last2=Evans |first2=R. H. |title=Historical and Descriptive Account of the Caricatures of James Gillray |location=London |publisher=Henry G. Bohn |date=1851 |oclc=59510372}}
  • Lua error: bad argument #1 to "get" (not a valid title).

In this example the {{citation}} template defines, and the {{harv}} template uses, the HTML ID "CITEREFWrightEvans1851", composed by concatenating the string "CITEREF" with the last names of the authors and the year. The {{harvid}} template can be used to generate such IDs, for example, {{harvid|Wright|Evans|1851}} generates "CITEREFWrightEvans1851".

Related methods which leave only a number in the text are to use the {{harvnb}} template enclosed in the <ref></ref> html code, or to use the {{sfn}} template alone. The example above would be <ref>{{harvnb|Wright|Evans|1851|p=ix}}</ref> or {{sfn|Wright|Evans|1851|p=ix}} both of which generate a footnote, such as

17. Wright & Evans 1851, p. ix

The names of only the first four authors are used; other author names are not concatenated to the ID. If no author names are given, editor names are used instead.

Last names are used, as specified by the parameters |last1= (or |last=), |last2=, |last3=, and |last4=, and similarly for |editor1-last= etc. and for |inventor1-last= etc. If a full name is given but no last name is specified, this template falls back on the full name, but this usage is not recommended. For example, in "{{Citation |author=Sigmund Freud |title=The Ego and the Id |date=1923}}" no last name is given, so this citation cannot be combined with the Harvard reference "{{harv|Freud|1923}}". To make these {{citation}} and {{harv}} invocations compatible, either replace "|author=Sigmund Freud" with "|first=Sigmund |last=Freud", or add "|ref={{harvid|Freud|1923}}" to the {{citation}} invocation, or add the same ref parameter (say, "|ref=EgoId") to both the {{citation}} and the {{harv}} invocations.

Similarly, the year is used, as specified by |year=. If no year is given, this template attempts to derive the year from |date= (or, if no date is given, from |publication-date=) by applying the MediaWiki § Time function. This heuristic works with most common date formats (American, International and ISO 8601 standard format YYYY-MM-DD as listed in WP:MOS), but may not work as expected with other formats, so when in doubt it may be safer to use |year=.

IDs must be unique

Names, years, and hand-specified IDs must be chosen so that the IDs are unique within a page; otherwise the HTML will not conform to the W3C standards, and any references to the citations will not work reliably. For example, suppose a page contains the following two citations with {{harv}}-compatible IDs:

  • Lua error: bad argument #1 to "get" (not a valid title).
  • Lua error: bad argument #1 to "get" (not a valid title).

If these citations were altered to say "2008" rather than "2008a" and "2008b", the resulting page would not work, because the two different citations would both attempt to use the ID "CITEREFMontesHalterman2008". To avoid this problem, distinguish the citations by appending suffixes to the years, e.g. "|date=2008a" and "|date=2008b", as was done above. Any Harvard references to these citations should use years with the same suffixes.

It is good practice to verify that a page does not contain duplicate IDs by using the W3C Markup Validation Service; see External links.

Dates

  1. The format of dates in the references of an article should use consistent and unambiguous styles. Example formats used in Wikipedia citations include: Dates should not be linked (say, to a Wikipedia article of the same name) in references. Please see Wikipedia:Manual of Style (dates and numbers) § Dates for more guidance about formatting dates.

Tools

See Wikipedia:Citing sources § Citation templates and tools for a list of tools that can help create a reference in the "citation" format.

TemplateData

Template:Notice

This is the TemplateData for this template used by TemplateWizard, VisualEditor and other tools. See a monthly parameter usage report for Template:Citation in articles based on its TemplateData.

TemplateData for Citation

The Citation template generates a citation for a book, periodical, contribution in a collective work, or a web page. It determines the citation type by examining which parameters are used.

Template parameters

ParameterDescriptionTypeStatus
Last namelast author author1 last1

The surname of the author; don't wikilink, use 'author-link' instead; can suffix with a numeral to add additional authors

Linesuggested
First namefirst first1

Given or first name, middle names, or initials of the author; don't wikilink, use 'author-link' instead; can suffix with a numeral to add additional authors

Linesuggested
Title of sourcetitle

Title of source. Works display in italics and articles surrounded in quotation marks.

Stringrequired
Date of sourcedate

Full date of source being referenced in the same format as other publication dates in the citations.[1] Do not wikilink. Displays after the authors and enclosed in parentheses. If there is no author, then displays after publisher.

Stringoptional
URL of sourceurl

URL of an online location where the text of the publication can be found.

Stringoptional
Workwork journal website newspaper magazine encyclopedia encyclopaedia dictionary mailinglist periodical

Name of the work in which the cited title is found

Stringoptional
Volumevolume

For one publication published in several volumes

Linesuggested
Issueissue number

Issue number

Stringoptional
Pagepage

Page in the source that supports the content; displays after 'p.'

Lineoptional
Pagespages

Pages in the source that support the content (not an indication of the number of pages in the source; displays after 'pp.'

Linesuggested
Publication datepublication-date

Date of publication when different from the date the work was written. Displays only if year or date are defined and only if different, else publication-date is used and displayed as date. Use the same format as other dates in the article; do not wikilink. Follows publisher; if work is not defined, then publication-date is preceded by "published" and enclosed in parenthesis.

Stringoptional
Date formatdf

Sets rendered dates to the specified format

Stringoptional
Year of publicationyear

Year of the source being referenced; recommended only when date parameter format is YYYY-MM-DD and a CITEREF disambiguator is needed

Numberoptional
Postscriptpostscript

Controls the closing punctuation for a citation; defaults to a period (.); for no terminating punctuation, specify |postscript=none – leaving |postscript= empty is the same as omitting it, but is ambiguous. Ignored if quote is defined.

Stringoptional
Editor last nameeditor-last editor editor-surname editor-last1 editor-surname1 editor1 editor1-last editor1-surname editors

The surname of the editor; don't wikilink, use 'editor-link'; can suffix with a numeral to add additional editors

Unknownoptional
Editor first nameeditor-first editor-first1 editor-given1 editor1-first editor1-given

The surname of the editor; don't wikilink, use 'editor-link'; can suffix with a numeral to add additional editors

Unknownoptional
Author maskauthor-mask authormask

Replaces the name of the first author with em dashes or text. Set author-mask to a numeric value n to set the dash n em spaces wide; set author-mask to a text value to display the text without a trailing author separator; for example, "with". You must still include the values for all authors for metadata purposes. Primarily intended for use with bibliographies or bibliography styles where multiple works by a single author are listed sequentially such as shortened footnotes. Do not use in a list generated by {{reflist}}, <references /> or similar as there is no control of the order in which references are displayed. You can also use editor-mask and translator-mask in the same way.

Stringoptional
Original yearorig-year origyear

Original year of publication; provide specifics

Numberoptional
Translated titletrans-title

An English language title, if the source cited is in a foreign language; 'language' is recommended

Contentoptional
Translated chapter titletrans-chapter

An English language chapter title, if the source cited is in a foreign language; 'language' is recommended

Contentoptional
Typetype

Additional information about the media type of the source; format in sentence case

Contentoptional
Archive URLarchive-url archiveurl

The URL of an archived copy of a web page, if or in case the URL becomes unavailable; requires 'archive-date'

Lineoptional
Seriesseries version

Series identifier when the source is part of a series, such as a book series or a journal; alias of 'version'

Contentoptional
Atat

May be used instead of 'page' or 'pages' where a page number is inappropriate or insufficient

Lineoptional
No ppnopp

Set to 'y' to suppress the 'p.' or 'pp.' display with 'page' or 'pages' when inappropriate (such as 'Front cover')

Lineoptional
Chapterchapter

The chapter heading of the source

Stringoptional
contributioncontribution

no description

Stringoptional
chapter-urlchapter-url chapterurl

no description

Stringoptional
contribution-urlcontribution-url

no description

Stringoptional
chapter-formatchapter-format

no description

Stringoptional
Othersothers

Free-text field for people involved in creating a work who cannot be added with another name parameter such as author or editor

Stringoptional
Editionedition

When the publication has more than one edition; for example: '2nd', 'Revised' etc.; suffixed with ' ed.'

Lineoptional
Location of publicationplace location

Geographical place of publication; usually not wikilinked

Stringoptional
Place of publicationpublication-place

Publication place shows after title; if 'place' or 'location' are also given, they are displayed before the title prefixed with 'written at'

Contentoptional
Publisherpublisher

Name of the publisher; displays after title

Contentoptional
Languagelanguage

The language in which the source is written, if not English; use the full language name; do not use icons or templates

Contentoptional
Formatformat

Format of the work referred to by 'url' ('url' is required when using 'format'); examples: PDF, DOC, XLS; do not specify HTML

Contentoptional
arXiv identifierarxiv

An identifier for arXive electronic preprints of scientific papers

Lineoptional
ASINasin ASIN

Amazon Standard Identification Number; 10 characters

Lineoptional
ASIN TLDasin-tld

ASIN top-level domain for Amazon sites other than the US

Lineoptional
Bibcodebibcode

Bibliographic Reference Code (REFCODE); 19 characters

Lineoptional
biorXivbiorxiv

biorXiv identifier; 6 digits

Lineoptional
CiteSeerXciteseerx

CiteSeerX identifier; found after the 'doi=' query parameter

Lineoptional
DOIdoi DOI

Digital Object Identifier; begins with '10.'

Stringoptional
DOI broken datedoi-broken-date

The date that the DOI was determined to be broken

Dateoptional
ISBNisbn

International Standard Book Number; use the 13-digit ISBN where possible

Lineoptional
ISSNissn

International Standard Serial Number (print); 8 characters; usually split into two groups of four using a hyphen

Lineoptional
eISSNeissn

International Standard Serial Number (online); 8 characters; usually split into two groups of four using a hyphen

Lineoptional
jfm codejfm

Jahrbuch über die Fortschritte der Mathematik classification code

Lineoptional
JSTORjstor

JSTOR identifier

Lineoptional
LCCNlccn

Library of Congress Control Number

Lineoptional
MRmr

Mathematical Reviews identifier

Lineoptional
OCLCoclc

Online Computer Library Center number

Numberoptional
OLol

Open Library identifier

Lineoptional
OSTIosti

Office of Scientific and Technical Information identifier

Lineoptional
PMCpmc

PubMed Center article number

Numberoptional
PMIDpmid

PubMed Unique Identifier

Lineoptional
RFCrfc

Request for Comments number

Numberoptional
SSRNssrn

Social Science Research Network

Lineoptional
Zblzbl

Zentralblatt MATH journal identifier

Lineoptional
idid

A unique identifier used where none of the specialized ones are applicable

Lineoptional
Quotequote

Relevant text quoted from the source; displays last, enclosed in quotes; needs to include terminating punctuation

Contentoptional
Refref

An anchor identifier; can be made the target of wikilinks to full references; special value 'harv' generates an anchor suitable for the harv and sfn templates

Lineoptional
URL access dateaccess-date accessdate

The full date when the original URL was accessed; do not wikilink

Dateoptional
Lay URLlay-url layurl

URL link to a non-technical summary or review of the source

Lineoptional
Lay sourcelay-source laysource

Name of the source of the laysummary; displays in italics, preceded by an en dash

Stringoptional
Lay datelay-date laydate

Date of the summary; displays in parentheses

Dateoptional
Name list stylename-list-style name-list-format

Sets the style for the list. Accepts 'amp', 'and', and 'vanc'. amp displays an ampersand after the penultimate name; and the same with 'and', and vanc displays in Vancouver format

Stringoptional
Display authorsdisplay-authors

number of authors to display before 'et al.' is used; must be less than the number listed

Numberoptional
Archive datearchive-date archivedate

Date when the original URL was archived; do not wikilink

Dateoptional
Last name 2last2 author2 surname2

The surname of the second author; don't wikilink, use 'author-link2' instead.

Lineoptional
First name 2first2 given2

Given or first name, middle names, or initials of the second author; don't wikilink.

Lineoptional
Last name 3last3 author3 surname3

The surname of the third author; don't wikilink, use 'author-link3' instead.

Lineoptional
First name 3first3 given3

Given or first name, middle names, or initials of the third author; don't wikilink.

Lineoptional
Last name 4last4 author4 surname4

The surname of the forth author; don't wikilink, use 'author-link4' instead.

Lineoptional
First name 4first4 given4

Given or first name, middle names, or initials of the forth author; don't wikilink.

Lineoptional
Last name 5last5 author5 surname5

The surname of the fifth author; don't wikilink, use 'author-link5' instead.

Lineoptional
First name 5first5 given5

Given or first name, middle names, or initials of the fifth author; don't wikilink.

Lineoptional
Last name 6last6 author6 surname6

The surname of the sixth author; don't wikilink, use 'author-link6' instead.

Lineoptional
First name 6first6

Given or first name, middle names, or initials of the sixth author; don't wikilink.

Lineoptional
Last name 7last7 author7 surname7

The surname of the seventh author; don't wikilink, use 'author-link7' instead.

Lineoptional
First name 7first7 given7

Given or first name, middle names, or initials of the seventh author; don't wikilink.

Lineoptional
Last name 8last8 author8 surname8

The surname of the eighth author; don't wikilink, use 'author-link8' instead.

Lineoptional
First name 8first8 given8

Given or first name, middle names, or initials of the eighth author; don't wikilink.

Lineoptional
Last name 9last9 author9 surname9

The surname of the ninth author; don't wikilink, use 'author-link9' instead. If nine authors are defined, then only eight will show and 'et al.' will show in place of the last author.

Lineoptional
First name 9first9 given9

Given or first name, middle names, or initials of the ninth author; don't wikilink.

Lineoptional
Author linkauthor-link authorlink author1-link authorlink1

Title of existing Wikipedia article about the author; can suffix with a numeral to add additional authors

Page nameoptional
Author link 2author-link2 author2-link authorlink2

Title of existing Wikipedia article about the second author.

Page nameoptional
Author link 3author-link3 author3-link authorlink3

Title of existing Wikipedia article about the third author.

Page nameoptional
Author link 4author-link4 author4-link authorlink4

Title of existing Wikipedia article about the forth author.

Page nameoptional
Author link 5author-link5 author5-link authorlink5

Title of existing Wikipedia article about the sixth author.

Page nameoptional
Author link 6author-link6 author6-link authorlink6

Title of existing Wikipedia article about the sixth author.

Page nameoptional
Author link 7author-link7 author7-link authorlink7

Title of existing Wikipedia article about the seventh author.

Page nameoptional
Author link 8author-link8 author8-link authorlink8

Title of existing Wikipedia article about the eighth author.

Page nameoptional
Author link 9author-link9 author9-link authorlink9

Title of existing Wikipedia article about the ninth author.

Page nameoptional
Editor last name 2editor2-last editor2

The surname of the second editor; don't wikilink, use 'editor2-link'.

Lineoptional
Editor first name 2editor2-first editor2-given

Given or first name, middle names, or initials of the second editor; don't wikilink.

Lineoptional
Editor last name 3editor3-last editor3

The surname of the third editor; don't wikilink, use 'editor3-link'.

Lineoptional
Editor first name 3editor3-first editor3-given

Given or first name, middle names, or initials of the third editor; don't wikilink.

Lineoptional
Editor last name 4editor4-last editor4

The surname of the fourth editor; don't wikilink, use 'editor4-link'.

Lineoptional
Editor first name 4editor4-first editor4-given

Given or first name, middle names, or initials of the fourth editor; don't wikilink.

Lineoptional
Editor last name 5editor5-last editor5

The surname of the fifth editor; don't wikilink, use 'editor5-link'.

Lineoptional
Editor first name 5editor5-first editor5-given

Given or first name, middle names, or initials of the fifth editor; don't wikilink.

Lineoptional
Editor last name 6editor6-last editor6

The surname of the sixth editor; don't wikilink, use 'editor6-link'.

Lineoptional
Editor first name 6editor6-first editor6-given

Given or first name, middle names, or initials of the sixth editor; don't wikilink.

Lineoptional
Editor last name 7editor7-last editor7

The surname of the seventh editor; don't wikilink, use 'editor7-link'.

Lineoptional
Editor first name 7editor7-first editor7-given

Given or first name, middle names, or initials of the seventh editor; don't wikilink.

Lineoptional
Editor last name 8editor8-last editor8

The surname of the eighth editor; don't wikilink, use 'editor8-link'.

Lineoptional
Editor first name 8editor8-first editor8-given

Given or first name, middle names, or initials of the eighth editor; don't wikilink.

Lineoptional
Editor last name 9editor9-last editor9

The surname of the ninth editor; don't wikilink, use 'editor9-link'.

Lineoptional
Editor first name 9editor9-first editor9-given

Given or first name, middle names, or initials of the ninth editor; don't wikilink.

Lineoptional
editor-linkeditor-link

no description

Stringoptional
editor1-linkeditor1-link

no description

Stringoptional
editor2-linkeditor2-link

no description

Stringoptional
editor3-linkeditor3-link

no description

Stringoptional
editor4-linkeditor4-link

no description

Stringoptional
Translator last nametranslator-last translator translator-last1 translator1 translator1-last

The surname of the translator; don't wikilink, use 'translator-link'; can suffix with a numeral to add additional translators.

Stringoptional
Translator first nametranslator-first translator1-first translator-first1

Given or first name, middle names, or initials of the translator; don't wikilink, use 'translator-link'; can suffix with a numeral to add additional translators.

Stringoptional
Translator linktranslator-link translator-link1 translator1-link

Title of existing Wikipedia article about the translator; can suffix with a numeral to add additional translators.

Page nameoptional
Translator last name 2translator-last2 translator2 translator2-last

The surname of the second translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator first name 2translator-first2 translator2-first

Given or first name, middle names, or initials of the second translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator last name 3translator-last3 translator3 translator3-last

The surname of the third translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator first name 3translator-first3 translator3-first

Given or first name, middle names, or initials of the third translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator last name 4translator-last4 translator4 translator4-last

The surname of the fourth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator first name 4translator-first4 translator4-first

Given or first name, middle names, or initials of the fourth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator last name 5translator-last5 translator5 translator5-last

The surname of the fifth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator first name 5translator-first5 translator5-first

Given or first name, middle names, or initials of the fifth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator last name 6translator-last6 translator6 translator6-last

The surname of the sixth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator first name 6translator-first6 translator6-first

Given or first name, middle names, or initials of the sixth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator last name 7translator-last7 translator7 translator7-last

The surname of the seventh translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator first name 7translator-first7 translator7-first

Given or first name, middle names, or initials of the seventh translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator last name 8translator-last8 translator8 translator8-last

The surname of the eighth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator first name 8translator-first8 translator8-first

Given or first name, middle names, or initials of the eighth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator last name 9translator-last9 translator9 translator9-last

The surname of the ninth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator first name 9translator-first9 translator9-first

Given or first name, middle names, or initials of the ninth translator; don't wikilink, use 'translator-link'.

Stringoptional
Translator link 2translator-link2 translator2-link

Title of existing Wikipedia article about the second translator.

Page nameoptional
Translator link 3translator-link3 translator3-link

Title of existing Wikipedia article about the third translator.

Page nameoptional
Translator link 4translator-link4 translator4-link

Title of existing Wikipedia article about the fourth translator.

Page nameoptional
Translator link 5translator-link5 translator5-link

Title of existing Wikipedia article about the fifth translator.

Page nameoptional
Translator link 6translator-link6 translator6-link

Title of existing Wikipedia article about the sixth translator.

Page nameoptional
Translator link 7translator-link7 translator7-link

Title of existing Wikipedia article about the seventh translator.

Page nameoptional
Translator link 8translator-link8 translator8-link

Title of existing Wikipedia article about the eighth translator.

Page nameoptional
Translator link 9translator-link9 translator9-link

Title of existing Wikipedia article about the ninth translator.

Page nameoptional

This template produces COinS metadata; see COinS in Wikipedia for background information.

See also

Notes

  1. Compare archived talk page.